close all open/close all

CDS information : Gelda2_00300


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction6,575 / 7,270 / + [in whole cluster]
6,575 / 7,270 / + [in contig]
Location6575..7270 [in whole cluster]
6575..7270 [in contig]
TypeCDS
Length696 bp (231 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative hydrolase
Product (GenBank)phosphatase-like
Geneahba-1b
Gene (GenBank)ahba1b
EC number
Keyword
  • AHBA
Note
Note (GenBank)
  • ORF7; AHBA biosynthetic pathway
Reference
ACC
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Related Reference
ACC
O52553
NITE
Rifam_00330
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
ACC
P32662
PmId
[13129953] Role of 2-phosphoglycolate phosphatase of Escherichia coli in metabolism of the 2-phosphoglycolate formed in DNA repair. (J Bacteriol. , 2003)
ACC
Q848B0
NITE
Gelda_00170
PmId
[16502293] Identification of AHBA biosynthetic genes related to geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Curr Microbiol. , 2006)
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
Family/Domain
FD
IPR006439

close this sectionSequence

selected fasta
>putative hydrolase [phosphatase-like]
MTSHPISHGAPLSGASTAPVTSVVFDLDGVLVNSFAVMREAFTLAYAEVVGEGEPPFEEY
NRHLGRYFPDIMRIMGLPLEMEAPFVRESYRLAHLVEMFDGVPELLSELRHRGLRLAVAT
GKSGPRARSLLDTLGIRGQFHVVLGSDEVARPKPAPDIVLKAMDLMDADPDRTVMVGDAV
TDLASARGAGITAVAAMWGETDEKTLLAAEPDVILHKPAELLALCPEVTAP
selected fasta
>putative hydrolase [phosphatase-like]
ATGACCAGCCATCCGATCAGTCACGGCGCCCCGCTCTCCGGCGCGAGTACCGCCCCGGTC
ACCTCGGTGGTCTTCGACCTCGACGGTGTCCTCGTCAACAGCTTCGCGGTGATGCGCGAG
GCGTTCACGCTCGCCTACGCCGAGGTCGTCGGCGAGGGTGAGCCACCCTTCGAGGAGTAC
AACCGGCATCTGGGCCGCTACTTCCCCGACATCATGCGGATCATGGGTCTTCCGCTGGAG
ATGGAGGCCCCGTTCGTCCGCGAGAGCTACCGGCTCGCCCACCTGGTGGAGATGTTCGAC
GGTGTGCCCGAGCTGCTGTCGGAGTTACGCCACCGCGGGCTGCGGCTCGCCGTGGCCACC
GGGAAGAGCGGACCCCGGGCGCGTTCGCTGCTCGACACGCTGGGCATCCGTGGCCAGTTC
CACGTGGTCCTCGGCTCCGACGAGGTGGCGCGGCCCAAGCCCGCGCCGGACATCGTGCTG
AAGGCGATGGACCTGATGGACGCCGATCCCGACCGAACCGTGATGGTCGGGGACGCGGTG
ACCGACCTGGCCAGCGCGCGGGGGGCCGGGATCACCGCCGTGGCGGCGATGTGGGGTGAG
ACCGACGAGAAGACGCTGCTCGCGGCGGAGCCCGATGTGATCCTGCACAAACCCGCCGAA
CTGCTGGCGCTCTGCCCCGAGGTGACGGCTCCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005833 Haloacid dehalogenase/epoxide hydrolase (Family)
 [20-31]  2.2999993566538e-07 PR00413 [109-122]  2.2999993566538e-07 PR00413 [140-156]  2.2999993566538e-07 PR00413 [158-178]  2.2999993566538e-07 PR00413
PR00413   HADHALOGNASE
IPR006351 3-amino-5-hydroxybenzoic acid synthesis-related (Family)
 [23-226]  1.5e-107 TIGR01454
TIGR01454   AHBA_synth_RP
IPR006402 HAD-superfamily hydrolase, subfamily IA, variant 3 (Family)
 [131-194]  3.4e-08 TIGR01509
TIGR01509   HAD-SF-IA-v3
IPR006439 HAD-superfamily hydrolase, subfamily IA, variant 1 (Family)
 [102-190]  1.6e-08 TIGR01549
TIGR01549   HAD-SF-IA-v1
IPR023214 HAD-like domain (Domain)
 [19-227]  4.19999771339582e-50 SSF56784
SSF56784   HAD-like_dom
 [20-38]  7.29999999999998e-41 G3DSA:3.40.50.1000 [91-223]  7.29999999999998e-41 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
SignalP No significant hit
TMHMM No significant hit