close all open/close all

CDS information : Gelda2_00310


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction8,174 / 7,542 / - [in whole cluster]
8,174 / 7,542 / - [in contig]
Locationcomplement(7542..8174) [in whole cluster]
complement(7542..8174) [in contig]
TypeCDS
Length633 bp (210 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative RNA polymerase ECF-type sigma factor
Product (GenBank)putative sigma factor
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF8; ECF family; similar to Streptomyces coelicolor SCO0864 and SCO0866
Reference
ACC
Related Reference
ACC
P66809
PmId
[10027986] Differential expression of 10 sigma factor genes in Mycobacterium tuberculosis. (Mol Microbiol. , 1999)
[15049808] Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. (Mol Microbiol. , 2004)
ACC
Q848B1
NITE
Gelda_00160
PmId
[16502293] Identification of AHBA biosynthetic genes related to geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Curr Microbiol. , 2006)

close this sectionSequence

selected fasta
>putative RNA polymerase ECF-type sigma factor [putative sigma factor]
MPSATLPAAPMRAMHGFTTAANDRQVTAWALAARDGDRDAVDHFIRATYRDVRRFVLHLS
ADPHGCEDLAQETYLRALTGLSRFAGRSSARTWLLSIARRVVVDRYRMTAARPRTLESDD
WQEVAERAQPVGLPGFDEGVALMDLLAGLAPARREMFLLTTVLGLPYADAATATGCPIGT
VRSRVARAREEITALLAAAEKAAEPVRLAG
selected fasta
>putative RNA polymerase ECF-type sigma factor [putative sigma factor]
ATGCCTTCCGCCACGCTGCCCGCCGCACCGATGAGAGCCATGCACGGCTTCACCACCGCG
GCGAACGACCGCCAGGTCACCGCATGGGCGCTGGCCGCCCGTGACGGCGACCGCGACGCG
GTCGACCACTTCATCCGCGCCACCTACCGCGATGTGCGCCGCTTCGTACTCCATCTCAGC
GCCGACCCCCACGGCTGTGAGGACCTCGCCCAGGAGACGTATCTGCGGGCGCTGACCGGA
CTCTCGCGCTTCGCCGGCCGCTCATCGGCCCGCACCTGGCTGCTGTCGATCGCCCGCCGG
GTGGTCGTCGACCGCTACCGCATGACCGCCGCCCGCCCCCGCACCCTGGAGTCGGACGAC
TGGCAGGAGGTGGCCGAACGGGCGCAGCCCGTCGGGCTCCCCGGGTTCGACGAGGGGGTG
GCGCTGATGGACCTGCTGGCTGGGCTCGCCCCGGCGCGCCGCGAGATGTTCCTCCTCACC
ACGGTACTCGGCCTGCCGTACGCGGACGCCGCCACCGCGACCGGCTGCCCCATCGGCACC
GTGCGCTCCCGTGTGGCCCGCGCCCGTGAGGAGATCACCGCACTGCTGGCCGCGGCCGAG
AAGGCCGCAGAACCCGTGCGGCTGGCGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007627 RNA polymerase sigma-70 region 2 (Domain)
 [45-108]  1.3e-13 PF04542
PF04542   Sigma70_r2
IPR013249 RNA polymerase sigma factor 70, region 4 type 2 (Domain)
 [141-191]  1.6e-13 PF08281
PF08281   Sigma70_r4_2
IPR013324 RNA polymerase sigma factor, region 3/4 (Domain)
 [131-198]  1.69999922284049e-09 SSF88659
SSF88659   Sigma_r3_r4
IPR013325 RNA polymerase sigma factor, region 2 (Domain)
 [18-130]  4.30000170645867e-21 SSF88946
SSF88946   Sigma_r2
IPR014284 RNA polymerase sigma-70 (Domain)
 [39-193]  1.1e-19 TIGR02937
TIGR02937   Sigma70-ECF
SignalP No significant hit
TMHMM No significant hit