close all open/close all

CDS information : Gelda2_00320


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction9,155 / 8,358 / - [in whole cluster]
9,155 / 8,358 / - [in contig]
Locationcomplement(8358..9155) [in whole cluster]
complement(8358..9155) [in contig]
TypeCDS
Length798 bp (265 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative integral membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF9; similar to Streptomyces coelicolor SCO0865 and SCO0867
Reference
ACC
Related Reference
ACC
Q848B2
NITE
Gelda_00150

close this sectionSequence

selected fasta
>hypothetical protein [putative integral membrane protein]
MSTFGGGPHATLVTGVMKIEPSSRAPATAGTMAAMSAGPPFRLARAAVFAAVCVVVTALG
HTLMSSDALPVWAVAAAFAATTAAAWWVAGRERGALVVTGATVVAQLGLHMAFRFAEMTV
APAAGSAMGHRMPGMRDMGTAPMSGGAMGHMHHGADAMSSAAPSMGHLPWPWAGPGGAGM
AAAHLLAALVCGLWLWRGERAAFRLGRALAALLFVPLVLALRILGAGATPLPAWPSAPAF
ARRPRGVLLRHAILRRGPPRRFAVR
selected fasta
>hypothetical protein [putative integral membrane protein]
ATGAGCACATTCGGGGGCGGCCCACACGCCACGCTTGTCACCGGCGTGATGAAGATTGAG
CCGTCGTCACGCGCACCGGCGACGGCTGGCACCATGGCTGCCATGTCCGCCGGGCCACCC
TTCCGTCTCGCACGAGCCGCCGTGTTCGCGGCGGTGTGCGTCGTGGTGACCGCGCTCGGG
CACACGCTGATGTCCAGCGACGCCCTGCCGGTGTGGGCCGTGGCCGCCGCGTTCGCCGCG
ACGACGGCCGCCGCGTGGTGGGTCGCCGGGCGCGAGCGCGGAGCGCTGGTCGTGACCGGT
GCGACGGTGGTCGCGCAACTCGGCCTGCACATGGCGTTCCGATTCGCGGAGATGACCGTC
GCTCCCGCCGCGGGAAGCGCCATGGGCCACCGGATGCCCGGTATGCGGGACATGGGCACC
GCCCCGATGAGCGGCGGCGCCATGGGCCACATGCACCATGGCGCGGACGCGATGTCCTCC
GCCGCGCCGTCGATGGGCCATCTGCCGTGGCCCTGGGCGGGCCCCGGCGGGGCGGGCATG
GCCGCGGCCCACCTGCTCGCCGCGCTGGTCTGCGGACTGTGGCTGTGGCGCGGCGAACGC
GCGGCCTTCCGCCTCGGCCGCGCGCTCGCGGCCCTGCTGTTCGTCCCGCTCGTCCTCGCC
CTGCGCATCCTCGGCGCGGGCGCCACTCCGCTGCCCGCATGGCCGTCCGCACCGGCCTTC
GCCCGCCGGCCGCGCGGAGTTCTGCTACGGCACGCCATTCTCCGCAGAGGGCCACCGAGG
CGGTTCGCCGTCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [41-63]  Transmembrane (i-o) [68-90]  Transmembrane (o-i) [95-113]  Transmembrane (i-o) [174-196]  Transmembrane (o-i) [209-231]  Transmembrane (i-o)
Transmembrane 5