close all open/close all

CDS information : Gelda2_00330


close this sectionLocation

Organism
StrainNRRL 3602 (=NBRC 14620)
Entry nameGeldanamycin
Contig
Start / Stop / Direction9,269 / 10,762 / + [in whole cluster]
9,269 / 10,762 / + [in contig]
Location9269..10762 [in whole cluster]
9269..10762 [in contig]
TypeCDS
Length1,494 bp (497 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative integral membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF10; similar to Streptomyces coelicolor SCO0863
Reference
ACC

close this sectionSequence

selected fasta
>hypothetical protein [putative integral membrane protein]
MSAEPLAPATGDSPDDVADREPRSLAEAESGGSGSGGSVWAGLRPLVLRLHFYAGVLVAP
FLLVAAVTGLLYAGSFQAEKLVYAHELRVPVGDRELPISAQVAAARKGHPEGEISAVRPS
PEDGATTRVLLSGVKGVDPDHTLAVFVDPYTGKVRGALEQYGSTGALPLRTWIDEFHRDL
HLGQTGRLYSELAASWLWVIALGGVVLWLSRRRKKRTLRAVALPDRAATGRKRTMSFHGA
VGLWVALGLLFLSATGLTWSTYAGANVEDLRTALGQTTPTVSATVGGGEHAGHHMGSGSM
PGMDMGGTGEAAGHTADAGLDTVLAAARAKDLDNPVEIVPPAEPGSAYVVSQIQRSWPEK
QDSVAVDPATGEVTDVQRFADYPVLAKLTRWGIDLHTGNLFGLVNQIALAALALALILLI
VWGYRMWWQRGRASAFGRPIPRGAWRRVPLYVLVPLAAATAVIGYYLPLLGIPLATFLAV
DIVAGEIARRRRAAPAA
selected fasta
>hypothetical protein [putative integral membrane protein]
ATGTCCGCTGAACCGCTCGCCCCGGCCACGGGCGATTCCCCGGATGATGTCGCCGACAGG
GAGCCACGCTCCCTCGCCGAGGCCGAGTCCGGCGGGTCCGGGTCCGGCGGGTCCGTATGG
GCGGGCCTGCGGCCGCTGGTGCTGCGGCTGCACTTCTACGCGGGGGTGCTGGTCGCGCCG
TTCCTGCTGGTCGCGGCGGTGACCGGACTGCTGTACGCCGGATCGTTCCAGGCCGAGAAG
CTGGTCTACGCCCACGAGTTGCGCGTCCCCGTCGGCGACCGTGAACTGCCGATCTCCGCA
CAGGTGGCAGCCGCGCGCAAGGGCCATCCCGAGGGTGAGATCAGCGCCGTACGGCCCTCC
CCCGAGGACGGCGCCACCACCCGGGTGCTGCTCTCCGGCGTCAAGGGCGTCGATCCCGAC
CACACATTGGCCGTGTTCGTCGACCCGTACACCGGGAAGGTGCGCGGGGCGCTGGAGCAG
TACGGCTCCACCGGCGCCCTCCCGCTGCGCACCTGGATCGATGAGTTCCACCGCGATCTG
CACCTCGGGCAGACCGGCCGCCTCTACAGCGAACTCGCCGCCAGCTGGCTGTGGGTCATC
GCCCTCGGCGGTGTGGTGCTCTGGCTCAGCCGTCGCCGTAAGAAGCGCACGCTGCGGGCG
GTCGCGCTGCCCGACCGCGCCGCCACCGGCCGCAAGCGCACCATGTCCTTCCATGGCGCG
GTGGGGCTGTGGGTGGCGCTCGGGCTGCTGTTCCTGTCCGCCACCGGCCTGACCTGGTCC
ACCTACGCGGGGGCCAACGTGGAGGACCTGCGCACCGCCCTCGGCCAGACCACCCCGACC
GTGTCGGCCACGGTCGGCGGCGGTGAACACGCCGGACACCACATGGGTTCCGGTTCCATG
CCGGGCATGGACATGGGCGGTACGGGCGAGGCGGCCGGGCACACCGCCGATGCGGGCCTG
GACACCGTGCTGGCGGCCGCCCGCGCCAAGGACCTGGACAACCCCGTCGAGATCGTCCCG
CCCGCCGAGCCGGGCAGTGCGTATGTCGTCAGCCAGATCCAGCGGAGCTGGCCCGAGAAG
CAGGACTCGGTGGCCGTCGACCCGGCCACGGGCGAGGTGACCGACGTCCAGCGGTTCGCC
GACTACCCGGTGCTCGCCAAGCTCACCCGCTGGGGCATCGACCTCCACACCGGAAACCTC
TTCGGCCTCGTCAATCAGATCGCCCTGGCCGCTCTCGCGCTCGCGCTGATCCTTCTGATC
GTCTGGGGCTATCGCATGTGGTGGCAGCGCGGTCGCGCCTCCGCCTTCGGCCGCCCGATC
CCCCGCGGCGCGTGGCGGCGGGTACCGCTGTACGTCCTCGTCCCCCTGGCCGCGGCCACC
GCCGTGATCGGCTACTACCTGCCCCTCCTCGGTATCCCGCTCGCGACCTTCCTGGCCGTC
GACATCGTCGCGGGCGAGATCGCCCGCCGGCGCCGCGCCGCCCCCGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM
 [52-74]  Transmembrane (i-o) [192-209]  Transmembrane (o-i) [241-263]  Transmembrane (i-o) [406-428]  Transmembrane (o-i) [448-470]  Transmembrane (i-o)
Transmembrane 5