close all open/close all

CDS information : Gelda_00020


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction18,572 / 19,345 / + [in whole cluster]
9,172 / 9,945 / + [in contig]
Location18572..19345 [in whole cluster]
9172..9945 [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative amide synthase
Product (GenBank)GdmF
Gene
Gene (GenBank)gdmF
EC number
Keyword
Note
Note (GenBank)
  • amide synthase; rifF
Reference
ACC
PmId
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
Related Reference
ACC
O52547
NITE
Rifam_00260
PmId
[9512878] Biosynthesis of the ansamycin antibiotic rifamycin: deductions from the molecular analysis of the rif biosynthetic gene cluster of Amycolatopsis mediterranei S699. (Chem Biol. , 1998)
[10430893] Direct evidence that the rifamycin polyketide synthase assembles polyketide chains processively. (Proc Natl Acad Sci U S A. , 1999)
[11812235] Expression and purification of the rifamycin amide synthase, RifF, an enzyme homologous to the prokaryotic arylamine N-acetyltransferases. (Protein Expr Purif. , 2002)
ACC
Q84G21
NITE
Gelda2_00110
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)

close this sectionSequence

selected fasta
>putative amide synthase [GdmF]
MFDVAKYLRRIGVESIPAPTLDTLRHLHKRHLMAVPYDNSTAPDRLPASRHLTNVPLDLV
FEHVVTEGHGGVCYELNRLFHTLLAELGYDVRMVAAAVRQANGAFGPEREHTFDLVRLDG
RTHLVDVGFPGPSYSEPLRLSEEEQHQYGCAYRVTEHDGYRVVERRPKESGWQPVYRFRP
ELADPSGWDAVRLDSLDDYAQDSVLAGTTFRSRATDNGKIVLIGRRCFTVEDGVERTKVL
VKADEFQDTVDLILAGE
selected fasta
>putative amide synthase [GdmF]
ATGTTCGACGTGGCGAAGTACCTGCGGCGCATCGGGGTGGAGTCCATACCCGCACCAACT
CTGGACACCCTCCGGCACCTGCACAAACGGCATCTCATGGCGGTCCCGTACGACAACTCG
ACGGCCCCCGACCGGCTCCCGGCCTCGCGGCATCTGACGAACGTCCCGCTGGACCTGGTG
TTCGAGCATGTGGTGACCGAGGGCCATGGCGGAGTGTGCTACGAGCTCAACCGGCTGTTC
CACACGCTGCTGGCCGAACTCGGCTACGACGTGCGCATGGTGGCGGCGGCGGTACGGCAG
GCGAACGGGGCCTTCGGCCCGGAGCGCGAGCACACCTTCGACCTGGTCCGCCTCGACGGG
CGGACCCACCTGGTGGACGTCGGTTTCCCCGGGCCGTCCTATTCGGAGCCGCTGCGCCTG
TCCGAGGAGGAGCAGCACCAGTACGGCTGTGCCTACCGCGTGACCGAACACGACGGCTAC
CGGGTGGTGGAACGGCGGCCCAAGGAGAGCGGCTGGCAGCCGGTGTACCGGTTCCGGCCG
GAGCTGGCCGACCCGTCCGGCTGGGACGCGGTGCGGCTGGACAGCCTGGACGACTACGCA
CAGGACTCGGTGCTCGCCGGGACCACCTTCCGCAGCCGGGCCACGGACAACGGAAAGATC
GTGCTGATCGGCAGGCGCTGCTTCACCGTCGAGGACGGGGTGGAGCGCACCAAGGTGCTG
GTGAAGGCGGACGAGTTCCAGGACACGGTCGATCTGATCCTGGCGGGCGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001447 Arylamine N-acetyltransferase (Family)
 [20-250]  9.1e-65 PF00797
PF00797   Acetyltransf_2
SignalP No significant hit
TMHMM No significant hit