close all open/close all

CDS information : Gelda_00030


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction19,342 / 20,985 / + [in whole cluster]
9,942 / 11,585 / + [in contig]
Location19342..20985 [in whole cluster]
9942..11585 [in contig]
TypeCDS
Length1,644 bp (547 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Productputative hydroxylase
Product (GenBank)GdmM
Gene
Gene (GenBank)gdmM
EC number
Keyword
Note
Note (GenBank)
  • FAD-dependent monooxygenase; rif19
Reference
ACC
PmId
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
Related Reference
ACC
Q84G20
NITE
Gelda2_00120
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
ACC
Q9AE02
NITE
Rifam_00520
PmId
[10430893] Direct evidence that the rifamycin polyketide synthase assembles polyketide chains processively. (Proc Natl Acad Sci U S A. , 1999)
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)
ACC
P77397
PmId
[9603882] Characterization of the hca cluster encoding the dioxygenolytic pathway for initial catabolism of 3-phenylpropionic acid in Escherichia coli K-12. (J Bacteriol. , 1998)

close this sectionSequence

selected fasta
>putative hydroxylase [GdmM]
MSGKETAVDVARDTDNGGPKTDVLIVGYGPVGQLLSVLLAQRGRRVTVVERWPEPYRHPR
AVGFDSEAARILASAGIGDSLEKFTEPARDHAWQNTKGETLIDHEVANRGHCTWPEALSA
YQPALESALIEHGATLPRLRVLRGYEAVGLADNGDRVTLTVVGPDGERTDLIASWVVGCD
GANSLVRASVGTTVTDLDFSYDWLICDVRLHEHREFRPNNLEICDPARPRTAVSAGPGHR
RYEFMRVPADDPAHFGTVESAWELLRLFDVTPDNGVLDRHAVYTFQARWAEHWRAGRLLL
AGDSAHLMPPFAGQGMCSGFRDAANLAWKLDLVLSGHAAPALLDTYTSERRAHVRHAVEM
SVGLGRVVCMADPAAAADRDAAMLAARKRNIGPSAARRSVVRPLVDGLLRRDGQGRPAPY
AGQAAPQWRVGRAGGTGLFDDVVGTGFILLYGEDVVPALDARQLTFLDNIGARLVRVVRA
ETPAADLEPGDARDVEGRYLPYLSEMGALAVLVRPDFYVFGIAGDKAELPSLVDDLAEQL
TPTAAPS
selected fasta
>putative hydroxylase [GdmM]
ATGAGCGGGAAGGAGACGGCGGTGGACGTCGCGCGGGACACGGACAACGGCGGGCCCAAG
ACCGATGTGCTGATCGTCGGGTACGGACCGGTGGGGCAGCTGCTGTCGGTGCTGCTGGCC
CAGCGCGGCCGCCGGGTGACGGTGGTGGAGCGCTGGCCGGAGCCGTACCGGCACCCCCGG
GCGGTCGGGTTCGACAGTGAGGCCGCGCGCATCCTGGCCTCGGCCGGGATCGGCGACTCG
CTCGAGAAGTTCACCGAACCCGCGCGGGACCACGCCTGGCAGAACACCAAGGGCGAGACG
CTGATCGACCACGAGGTCGCCAACCGGGGGCACTGCACCTGGCCGGAGGCGCTGTCGGCC
TATCAGCCGGCCCTGGAGTCCGCACTGATCGAACACGGGGCGACGCTGCCGCGGCTGCGG
GTGCTGCGCGGCTACGAGGCGGTGGGACTCGCGGACAACGGTGACCGGGTGACCTTGACC
GTGGTCGGTCCGGACGGCGAGAGGACGGACCTCATCGCTTCGTGGGTGGTCGGCTGCGAC
GGCGCCAACAGCCTGGTGCGGGCGAGTGTCGGCACCACGGTGACGGACCTCGACTTCTCC
TACGACTGGCTGATCTGCGATGTGCGGCTGCATGAGCACCGCGAGTTCCGGCCGAACAAT
CTGGAGATCTGCGATCCGGCCCGCCCGCGGACCGCGGTGTCCGCGGGGCCCGGACACCGG
CGGTACGAGTTCATGCGGGTGCCCGCGGACGACCCCGCGCACTTCGGCACCGTGGAGAGC
GCGTGGGAGCTGCTGCGGCTGTTCGACGTGACGCCCGACAACGGCGTCCTGGACCGGCAT
GCGGTCTACACCTTCCAGGCCCGCTGGGCGGAGCACTGGCGGGCCGGACGGCTGCTGCTG
GCCGGGGACTCGGCGCACCTCATGCCGCCGTTCGCGGGGCAGGGCATGTGCTCCGGATTC
CGTGACGCGGCGAATCTGGCCTGGAAGCTGGACCTGGTGCTGAGCGGGCACGCGGCACCG
GCGCTGCTGGACACCTACACCAGCGAGCGGCGGGCGCATGTGCGGCACGCGGTGGAGATG
TCCGTGGGCCTGGGCCGGGTGGTGTGCATGGCGGACCCGGCCGCGGCGGCGGACCGGGAC
GCGGCGATGCTGGCCGCGCGGAAGCGGAACATCGGGCCGAGCGCCGCGCGCCGCTCGGTG
GTGCGCCCGCTCGTGGACGGGTTGCTGCGGCGGGACGGGCAGGGCCGGCCGGCGCCGTAC
GCCGGACAGGCGGCCCCACAGTGGCGGGTGGGCCGCGCGGGCGGCACCGGGCTGTTCGAC
GATGTGGTGGGCACCGGTTTCATCCTGCTGTACGGCGAGGACGTGGTCCCGGCGCTGGAC
GCGCGGCAGCTGACGTTCCTCGACAACATCGGGGCCCGGCTGGTGCGTGTGGTGCGCGCG
GAAACGCCCGCGGCCGACCTGGAACCAGGGGACGCGCGGGACGTGGAGGGCCGGTATCTG
CCGTATCTGTCGGAGATGGGCGCGCTGGCGGTGCTGGTACGCCCGGACTTCTACGTGTTC
GGCATCGCGGGCGACAAGGCCGAACTGCCCTCGCTGGTGGACGACTTGGCGGAACAACTC
ACCCCGACCGCCGCCCCGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [20-360]  7.69999999999997e-64 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [22-44]  1.3000049540733e-34 PR00420 [172-187]  1.3000049540733e-34 PR00420 [295-310]  1.3000049540733e-34 PR00420 [310-326]  1.3000049540733e-34 PR00420 [328-346]  1.3000049540733e-34 PR00420 [346-362]  1.3000049540733e-34 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit