close all open/close all

CDS information : Gelda_00040


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction23,530 / 21,479 / - [in whole cluster]
14,130 / 12,079 / - [in contig]
Locationcomplement(21479..23530) [in whole cluster]
complement(12079..14130) [in contig]
TypeCDS
Length2,052 bp (683 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative carbamoyltransferase
Product (GenBank)GdmN
Gene
Gene (GenBank)gdmN
EC number2.1.3.-
Keyword
Note
Note (GenBank)
  • carbamoyltransferase; hbmN
Reference
ACC
PmId
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
[18667782] A new post-PKS modification process in the carbamoyltransferase gene inactivation strain of Streptomyces hygroscopicus 17997. (J Antibiot (Tokyo). , 2008)
[20683449] 7-O-descarbamoyl-7-hydroxygeldanamycin, a minor component from the gdmN disruption mutant of Streptomyces hygroscopicus 17997. (J Antibiot (Tokyo). , 2010)
Related Reference
ACC
Q84G19
NITE
Gelda2_00130
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)
ACC
Q8KUG9
NITE
Ansam_00230
PmId
[14624546] The post-polyketide synthase modification steps in the biosynthesis of the antitumor agent ansamitocin by Actinosynnema pretiosum. (J Am Chem Soc. , 2003)
[22195559] Dual carbamoylations on the polyketide and glycosyl moiety by asm21 result in extended ansamitocin biosynthesis. (Chem Biol. , 2011)

close this sectionSequence

selected fasta
>putative carbamoyltransferase [GdmN]
MLGLNGNFSAADTDVVPRLSEVFFHDSAASLIRDGELVAAVEEERLNRIKKTTKFPINAV
RECLALAGARPEDVDAVGYYFPENHIDTVLNHLYTEYPRVPLRYSRELIRERLKEGLDWD
LPEDKLVYVPHHEAHAYSTYLHSGMDSALVLVLDGRGELHSGTVYRAEGTHLERLADYPV
PKSLGGLYLNATYLLGYGFGDEYKVMGLAPWGDPATYRDTFSKLYTLQDNGEYELHGNIM
VPNLVSPLFYAEGFRPRRKSEPFTQAHRDFAAALQEAVEKIVLHILQHWAKTSGLSRLCF
GGGVAHNSSLNGLILKSGLFDEVFIHPASHDAGAGEGAAYAAAASLGTLQRPRKRLLSAS
LGPALGTRERIRARLADWAPLIDVEFPGDAVERAAGLLAEGEVLGWAYGRSEFGPRALGH
RSIVADARPEENRTRINAMVKKREGFRPFAPVVTAEAARDYFDLSGAEGNHEFMSFVVPV
LPERRTELGAVTHVDGTARVQVVSAASGERFHRLVRRFGELTGTPVLLNTSFNNNAEPIV
QSLDDVVTSFLTTDLDALVVEDCLVRAKPSPDLGVLVPRFRPVTRLVEHRTSGPDASAGT
KVHEIHLDYDGGPSAKVSPELYELLGAVDGTTTLGDLAKAVGGLSEALAAEVFALWEQRF
LTLVPAGELQPAQGPADDGARGR
selected fasta
>putative carbamoyltransferase [GdmN]
GTGCTCGGGCTCAACGGCAACTTCTCCGCCGCGGACACCGATGTGGTGCCGCGGCTGAGC
GAGGTCTTCTTCCACGACTCGGCGGCCTCCCTGATCCGCGACGGGGAACTCGTGGCCGCG
GTGGAGGAGGAGCGGCTCAACCGGATCAAGAAGACCACCAAATTCCCCATCAACGCGGTC
CGTGAGTGCCTGGCCCTGGCCGGCGCGCGGCCCGAGGACGTCGACGCGGTGGGCTACTAC
TTTCCCGAGAACCACATCGACACCGTCCTCAACCACCTCTACACCGAATATCCGCGGGTG
CCCCTGCGCTACTCCCGGGAGCTGATCCGGGAGCGGCTGAAGGAGGGCCTGGACTGGGAC
CTGCCGGAGGACAAGCTCGTCTATGTGCCGCACCACGAGGCACACGCGTACTCCACATAT
CTGCACTCCGGCATGGACTCGGCGCTGGTCCTGGTGCTGGACGGCCGGGGCGAACTGCAC
TCCGGCACCGTCTACCGCGCCGAGGGCACCCACCTGGAGAGGCTGGCCGACTACCCGGTG
CCCAAGTCACTGGGCGGGCTCTATCTGAACGCCACCTATCTGCTCGGCTACGGCTTCGGC
GACGAGTACAAGGTGATGGGCCTGGCCCCCTGGGGCGACCCCGCGACCTACCGCGACACC
TTCTCCAAGCTCTACACCCTCCAGGACAACGGCGAGTACGAACTGCACGGCAACATCATG
GTGCCGAACCTGGTCAGCCCGCTGTTCTACGCCGAGGGCTTCCGGCCGCGCCGCAAGAGC
GAGCCGTTCACCCAAGCACACCGCGACTTCGCCGCCGCGCTCCAGGAGGCGGTCGAGAAG
ATCGTGCTGCACATCCTCCAGCACTGGGCGAAGACCAGCGGGCTGTCCCGCCTCTGCTTC
GGCGGCGGCGTCGCCCACAACTCCAGCCTCAACGGCCTGATCCTCAAGTCCGGCCTCTTC
GACGAGGTGTTCATCCACCCCGCCTCGCACGACGCGGGCGCGGGCGAGGGCGCCGCCTAC
GCCGCCGCGGCGAGCCTGGGCACTCTCCAACGGCCCCGGAAGCGGCTGCTCAGCGCGAGT
CTCGGCCCGGCGCTGGGCACCCGGGAGCGGATCAGGGCACGGCTGGCCGACTGGGCGCCG
CTGATCGATGTGGAGTTCCCCGGAGACGCCGTGGAGAGGGCGGCCGGACTGCTCGCCGAG
GGCGAGGTGCTCGGCTGGGCGTACGGCCGGTCCGAGTTCGGCCCCCGCGCCCTGGGCCAC
CGCAGCATCGTCGCGGACGCACGCCCCGAGGAGAACCGGACCCGTATCAACGCGATGGTG
AAGAAGCGCGAGGGCTTCCGGCCGTTCGCACCGGTGGTCACCGCCGAAGCCGCCCGCGAC
TACTTCGACCTCTCCGGCGCGGAGGGCAACCACGAGTTCATGTCCTTCGTGGTGCCGGTG
CTGCCGGAGCGGCGTACCGAACTCGGCGCGGTCACCCACGTGGACGGCACCGCCCGGGTG
CAGGTCGTCTCGGCCGCCTCGGGCGAGCGCTTCCATCGGCTGGTACGCCGGTTCGGCGAG
CTGACCGGCACCCCCGTGCTGCTCAACACCTCCTTCAACAACAACGCCGAACCCATCGTG
CAGAGCCTCGACGACGTGGTGACCAGCTTCCTGACCACCGACCTGGACGCCCTGGTGGTG
GAGGACTGCCTGGTGCGTGCCAAGCCCTCGCCCGACCTGGGCGTTCTGGTGCCGCGGTTC
CGCCCGGTCACCCGGCTGGTCGAGCACAGGACCAGCGGTCCCGACGCCTCGGCGGGCACG
AAGGTCCACGAGATCCACCTCGACTACGACGGCGGCCCGTCCGCGAAGGTGTCGCCCGAG
CTGTACGAACTGCTCGGCGCGGTGGACGGCACCACCACCCTCGGGGATCTGGCCAAGGCC
GTGGGCGGGCTGTCGGAGGCGCTGGCCGCCGAGGTGTTCGCCCTGTGGGAGCAGCGGTTC
CTCACCCTCGTCCCGGCCGGGGAGCTCCAGCCGGCCCAGGGGCCCGCGGACGACGGCGCG
CGGGGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003696 Carbamoyltransferase (Family)
 [137-501]  5.30000000000001e-89 PF02543
PF02543   CmcH_NodU
SignalP No significant hit
TMHMM No significant hit