close all open/close all

CDS information : Gelda_00050


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction24,710 / 23,598 / - [in whole cluster]
15,310 / 14,198 / - [in contig]
Locationcomplement(23598..24710) [in whole cluster]
complement(14198..15310) [in contig]
TypeCDS
Length1,113 bp (370 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative glyceroyl-ACP biosynthesis protein
putative 1,3-bisphospho-D-glycerate phosphatase/glyceroyltransferase
Product (GenBank)GdmH
Gene
Gene (GenBank)gdmH
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • putative methoxymalonyl-ACP; fkbH
Reference
ACC
PmId
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
Related Reference
ACC
Q1G727
NITE
Oxzol_00080
PmId
[16895402] The bifunctional glyceryl transferase/phosphatase OzmB belonging to the HAD superfamily that diverts 1,3-bisphosphoglycerate into polyketide biosynthesis. (J Am Chem Soc. , 2006)
ACC
Q8KUG4
NITE
Ansam_00180
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
[17076505] On the biosynthetic origin of methoxymalonyl-acyl carrier protein, the substrate for incorporation of "glycolate" units into ansamitocin and soraphen A. (J Am Chem Soc. , 2006)
ACC
Q9KIE6
NITE
Asco_00080
PmId
[15179529] Engineered biosynthesis of 16-membered macrolides that require methoxymalonyl-ACP precursors in Streptomyces fradiae. (Appl Microbiol Biotechnol. , 2004)
ACC
Q84G18
NITE
Gelda2_00140
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)

close this sectionSequence

selected fasta
>putative glyceroyl-ACP biosynthesis protein [GdmH]
MTEGKPVSEPPAAVKCLVWDLDNTLWRGTLLEDGEVPPFAWVRDVITTLDDRGILQSIAS
KNDHDHAWARLEALGLAEYFVLPHIGWGPKSESVRAIAERLNFAHRAMAFVDDQPAERAE
VGYRLPEVRCYTAEDVAGLTGLPEFSPAVVTVDSRQRRTMYQSGFRRDAERAEFGGPDEE
FLRTLDIEMAISRATERELSRVEELTLRTSQMNATGVHYSDSVLRGLLTDPAHEVLVITM
ADRFGPHGAVGIVLLERHPAVWHLKLLATSCRVVSYGAGSTLLNWLADQAARAGVHLAAD
FRRTDRNRMMEVAYRFAGFADADCACTAALAAPGEEGVERLHLTPAFQPAPTTLRLTAPE
LADAALPRSR
selected fasta
>putative glyceroyl-ACP biosynthesis protein [GdmH]
ATGACGGAGGGGAAGCCCGTGAGCGAGCCGCCGGCGGCCGTCAAATGTCTCGTCTGGGAC
CTCGACAACACACTCTGGCGCGGCACCCTGCTCGAGGACGGCGAGGTGCCGCCGTTCGCA
TGGGTGCGCGATGTCATCACCACCCTCGACGACCGCGGCATTCTCCAGTCGATCGCCAGC
AAGAACGACCACGACCACGCCTGGGCGCGCCTGGAGGCGCTGGGCCTCGCCGAGTACTTC
GTGCTGCCGCACATCGGCTGGGGGCCCAAGTCGGAATCGGTGCGTGCCATCGCGGAGCGG
CTGAACTTCGCACACCGTGCCATGGCCTTCGTGGACGACCAGCCCGCCGAGCGCGCCGAG
GTCGGCTACCGGCTCCCCGAGGTGCGCTGCTACACCGCCGAGGACGTGGCCGGACTCACC
GGGCTGCCCGAGTTCAGCCCCGCCGTGGTCACCGTGGACTCACGGCAGCGGCGCACCATG
TACCAGTCGGGGTTCCGCCGTGACGCCGAGCGGGCGGAGTTCGGCGGACCCGACGAGGAG
TTCCTGCGCACCCTGGACATCGAGATGGCCATCTCCCGCGCCACCGAGCGGGAGCTGTCC
CGGGTCGAGGAACTGACCCTGCGCACCAGCCAGATGAACGCCACCGGTGTGCACTACTCC
GACTCCGTACTGCGCGGACTGCTCACCGACCCCGCGCACGAGGTGCTGGTCATCACGATG
GCCGACCGGTTCGGCCCGCACGGCGCCGTCGGCATCGTGCTGCTGGAACGCCACCCGGCG
GTGTGGCATCTGAAACTGCTCGCCACCTCCTGCCGTGTGGTCTCCTACGGCGCCGGGTCC
ACCCTGCTGAACTGGCTGGCCGACCAGGCGGCGCGTGCCGGGGTGCATCTGGCCGCCGAC
TTCCGGCGCACCGACCGCAACCGGATGATGGAGGTCGCCTACCGCTTCGCCGGGTTCGCC
GACGCCGACTGCGCCTGCACCGCCGCCCTCGCGGCCCCCGGCGAGGAGGGCGTCGAACGC
CTCCACCTCACCCCCGCGTTCCAGCCGGCCCCGACCACGCTGCGGCTGACCGCGCCTGAG
CTCGCCGACGCGGCGCTGCCGCGCTCCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010033 HAD-superfamily phosphatase, subfamily IIIC (Domain)
 [15-123]  5.9e-20 TIGR01681
TIGR01681   HAD-SF-IIIC: HAD phosphatase, family IIIC
IPR010037 FkbH domain (Domain)
 [13-323]  6.5e-113 TIGR01686
TIGR01686   FkbH: FkbH domain
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [188-296]  6.7e-07 SSF55729
SSF55729   Acyl-CoA N-acyltransferases (Nat)
 [189-320]  1.9e-05 G3DSA:3.40.630.30
G3DSA:3.40.630.30   no description
IPR023214 HAD-like domain (Domain)
 [11-115]  5.3e-16 SSF56784
SSF56784   HAD-like
 [14-116]  3.4e-09 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   no description
SignalP No significant hit
TMHMM No significant hit