close all open/close all

CDS information : Gelda_00070


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction26,091 / 25,816 / - [in whole cluster]
16,691 / 16,416 / - [in contig]
Locationcomplement(25816..26091) [in whole cluster]
complement(16416..16691) [in contig]
TypeCDS
Length276 bp (91 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyl carrier protein
Product (GenBank)GdmJ
Gene
Gene (GenBank)gdmJ
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • ACP in methoxymalonyl-ACP biosynthesis pathway; fkbJ
Reference
ACC
PmId
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
Related Reference
ACC
Q84G16
NITE
Gelda2_00160
PmId
[17080682] Production of ansamycin polyketide precursors in Escherichia coli. (J Antibiot (Tokyo). , 2006)
ACC
Q8KUG2
NITE
Ansam_00160
PmId
[11960423] Identification of a set of genes involved in the formation of the substrate for the incorporation of the unusual "glycolate" chain extension unit in ansamitocin biosynthesis. (J Am Chem Soc. , 2002)
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
ACC
Q9KIE4
NITE
Asco_00100
PmId
[15179529] Engineered biosynthesis of 16-membered macrolides that require methoxymalonyl-ACP precursors in Streptomyces fradiae. (Appl Microbiol Biotechnol. , 2004)
Family/Domain
FD
IPR009081

close this sectionSequence

selected fasta
>putative acyl carrier protein [GdmJ]
MTISSEQGSHTAETVAREVQQFLEQRTKQTWDPDTDLFSTGAVSSMFAMELVVHLESSFD
VVISGPDLALDNFRTVNAMTAMVLRLRGVKP
selected fasta
>putative acyl carrier protein [GdmJ]
GTGACCATCTCATCCGAGCAGGGCAGCCACACCGCCGAGACGGTGGCGCGGGAGGTGCAG
CAGTTCCTCGAACAGCGCACCAAGCAGACCTGGGACCCGGACACCGACCTGTTCAGCACC
GGCGCCGTGTCCTCGATGTTCGCCATGGAACTGGTCGTGCACCTGGAGTCGTCCTTCGAC
GTGGTGATCAGCGGCCCCGATCTGGCGCTGGACAACTTCCGTACGGTGAACGCGATGACC
GCGATGGTCCTGCGGCTGCGCGGGGTCAAGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [15-83]  7.2e-07 PF00550
PF00550   PP-binding
 [13-85]  6.5e-12 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [7-87]  1.5e-11 SSF47336
SSF47336   ACP-like
SignalP No significant hit
TMHMM No significant hit