close all open/close all

CDS information : Gelda_00090


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction27,200 / 27,856 / + [in whole cluster]
17,800 / 18,456 / + [in contig]
Location27200..27856 [in whole cluster]
17800..18456 [in contig]
TypeCDS
Length657 bp (218 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative O-methyltransferase
Product (GenBank)gdmG
Gene
Gene (GenBank)gdmG
EC number2.1.1.-
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • putative O-methyltransferase; fkbG
Reference
ACC
PmId
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
Related Reference
ACC
Q9KIE7
NITE
Asco_00070
PmId
[15179529] Engineered biosynthesis of 16-membered macrolides that require methoxymalonyl-ACP precursors in Streptomyces fradiae. (Appl Microbiol Biotechnol. , 2004)
ACC
Q8KUG5
NITE
Ansam_00190
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
ACC
P28034
PmId
[1894629] Molecular cloning, induction and taxonomic distribution of caffeoyl-CoA 3-O-methyltransferase, an enzyme involved in disease resistance. (J Biol Chem. , 1991)
[9037150] Structure of the parsley caffeoyl-CoA O-methyltransferase gene, harbouring a novel elicitor responsive cis-acting element. (Plant Mol Biol. , 1997)
ACC
Q84G14
NITE
Gelda2_00180
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)

close this sectionSequence

selected fasta
>putative O-methyltransferase [gdmG]
MAQQVDVTEEILGYVRELSLRDDEVLAGLRAETAGLPAAQAMQVMPEEGQLLGLLVRLVG
ARSVLEIGTFTGYSTLCMARALPADGTLITCDITEKWPGLGRPFWERAEVADRIDVRIGD
AKDTLAGLRRAGREFDLVFIDADKTGYAHYYEESLAMLRRGGLIVLDNTLFFGRVTDPAA
QDADTAALREMNKLLREDGRVEISMLTVGDGITLAVKR
selected fasta
>putative O-methyltransferase [gdmG]
ATGGCTCAGCAAGTCGATGTGACCGAAGAAATTCTCGGCTATGTCCGGGAACTGTCCCTG
CGCGACGACGAGGTCCTGGCCGGGCTGCGGGCGGAAACCGCGGGTCTGCCGGCCGCACAG
GCCATGCAGGTGATGCCCGAGGAGGGTCAGCTCCTCGGGCTGCTGGTGCGGCTCGTCGGT
GCCCGTTCGGTGCTGGAGATCGGCACCTTCACCGGCTACAGCACACTGTGCATGGCGCGG
GCCCTGCCGGCCGACGGCACGCTGATCACCTGCGACATCACGGAGAAGTGGCCGGGGCTC
GGGCGTCCGTTCTGGGAGCGCGCCGAAGTGGCGGACCGCATCGATGTGCGCATCGGTGAC
GCGAAGGACACACTGGCCGGACTGCGGCGGGCGGGCCGGGAGTTCGACCTGGTCTTCATC
GACGCGGACAAGACCGGCTACGCGCACTATTACGAGGAGTCACTGGCGATGCTCCGGCGC
GGCGGCCTCATCGTCCTGGACAACACCCTCTTCTTCGGCCGGGTGACCGACCCCGCCGCA
CAGGACGCCGACACCGCCGCCCTGCGCGAGATGAACAAACTGCTCCGGGAGGACGGACGC
GTCGAGATCAGCATGCTCACCGTGGGCGATGGGATCACGCTGGCGGTCAAACGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002935 O-methyltransferase, family 3 (Family)
 [17-217]  6.5e-81 PF01596
PF01596   Methyltransf_3
SignalP No significant hit
TMHMM No significant hit