close all open/close all

CDS information : Gelda_00100


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction30,746 / 27,963 / - [in whole cluster]
21,346 / 18,563 / - [in contig]
Locationcomplement(27963..30746) [in whole cluster]
complement(18563..21346) [in contig]
TypeCDS
Length2,784 bp (927 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional activator
Product (GenBank)GdmRII
Gene
Gene (GenBank)gdmRII
EC number
Keyword
Note
Note (GenBank)
  • putative transcriptional regulator; hbmRII
Reference
ACC
PmId
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
Related Reference
ACC
Q84G13
NITE
Gelda2_00190
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)

close this sectionSequence

selected fasta
>LuxR family transcriptional activator [GdmRII]
MPFSYAMPVNTERNSHPMDTVLNAAAHLGHAFGDSLVRPGQALLLDGPLACGKTTLLRSF
AERAAAAGRLVITATCSPCERDLPFGVVSQLARGARKSAGGPPEVPGLPDILRGTSDPVD
RAEIARLCHRLCTLLIDYAEHTPLLLAVDDVRHSDPASAHFLLQLVRRLDSARIAAVFTD
DLSLPAPTLPLRYELLRSQRLHRIGLGPLTPDEVADVVVAELGETASPRAGDVYAATGGN
RLLLHTLLADYREHGEARQTGYGQSFLSCLHRNEPIFLDVVRALAVVGFSLPATDLAWLT
GHEPEPIGQVLAALTGAGLMDEGAFRQEAARLSVLNDTPALTRRTLHQRAARLLHDQGRP
ATTIARHLVRAGRIPDSWSPELLLEVAEQVAVGEEASVAVDLLEQSLEQCPHQERRAALQ
AKLAEAEWKINPSTATRHHTPLYGAVRAGRLGLPDSVTLLMQLLWKGGLTEVEGLLAHLR
EDPAATDQLHAIEAALTCTYPWLAERRPAPAHHGGSAATRAAVWPRAGTVLADVLTGGQT
HDTVRRAEEVLRELQLGHDPACQEQAGLFALLALVYGGRIDLASAWCEGALGETGAGPHV
PMRQAVLAAARSEIALRRGDLAEAAERSRAALTHASPGAWGVAVGLPLGSLILACTRMGR
HEEAGFHVAQTVPNAMFKSSYGLHYLYARGHYFLAAGRHQAALADFLLCGELLTDWGLSS
GCDPVPWRIGAAEAWLAQGNHDQARILVYQQLSRPHTDGARARGQSLRLLAATSSAKRRP
QLLNEAVGLFTEQEDKYELARTLWDLSQAYHALGEKKQARRTMRRAWHVAKMCDAASLYE
EWLPADDQSQAVAPAPKADAGIERLTHSERRVASLAAMGYTNREIAGKLYVTASTVEQHL
TRVFRKLDIKHREQLPTELYADRMELA
selected fasta
>LuxR family transcriptional activator [GdmRII]
ATGCCCTTCAGCTATGCCATGCCGGTGAATACCGAGCGGAATTCCCATCCGATGGACACG
GTATTGAATGCCGCGGCGCACCTCGGACACGCGTTCGGTGACTCTTTGGTGCGGCCCGGG
CAGGCTCTTCTCCTGGACGGACCGCTGGCATGCGGTAAGACCACCCTGCTCCGGTCGTTC
GCCGAGCGGGCCGCGGCGGCCGGCCGGCTCGTCATCACGGCGACGTGTTCTCCCTGCGAG
CGGGATCTTCCCTTCGGTGTCGTCTCCCAACTGGCCCGCGGCGCCCGGAAGTCAGCGGGC
GGGCCGCCCGAGGTGCCGGGGCTGCCGGACATCCTCCGCGGGACCAGCGACCCGGTGGAC
CGGGCCGAGATCGCCCGGCTGTGCCATCGGCTGTGCACCTTGCTGATCGACTACGCGGAA
CACACCCCGCTGCTGCTCGCCGTGGACGATGTGCGCCACAGCGATCCGGCCTCCGCGCAC
TTCCTCCTCCAACTGGTGCGGCGGCTGGACTCGGCACGGATCGCCGCCGTGTTCACCGAC
GATCTGAGCCTGCCCGCGCCCACCCTGCCGCTCCGCTACGAACTGCTGCGCTCCCAGCGC
CTGCACCGGATCGGCCTCGGCCCGCTCACCCCCGACGAGGTGGCCGACGTGGTCGTGGCG
GAGCTGGGGGAGACCGCGAGCCCCCGCGCCGGCGATGTCTACGCCGCCACCGGTGGCAAC
CGGCTGCTGCTGCACACCCTGCTGGCCGACTACCGCGAGCACGGCGAGGCCCGCCAGACC
GGCTATGGCCAGTCCTTCCTGAGCTGTCTGCACCGCAATGAGCCGATCTTCCTGGACGTG
GTGCGCGCGCTGGCCGTGGTGGGCTTCTCCTTGCCCGCCACCGACCTGGCCTGGCTGACC
GGACACGAGCCCGAGCCCATCGGCCAGGTGCTGGCGGCGCTGACCGGCGCCGGACTGATG
GACGAGGGCGCGTTCCGGCAGGAGGCGGCGCGGCTGAGCGTGCTCAACGACACGCCGGCG
CTGACCCGCAGGACCCTGCACCAGCGGGCCGCGCGGCTGCTGCACGACCAGGGCAGGCCC
GCCACCACGATCGCCCGTCATCTGGTGCGGGCCGGGCGGATCCCCGATTCATGGTCGCCG
GAGCTGCTGCTGGAAGTGGCCGAGCAGGTCGCGGTGGGCGAAGAGGCGTCCGTCGCCGTC
GACTTACTGGAGCAGTCCCTCGAACAGTGTCCGCACCAGGAGCGGCGCGCCGCCTTGCAG
GCGAAGCTCGCCGAGGCGGAATGGAAGATCAACCCGTCCACCGCCACCCGGCACCACACA
CCGCTGTACGGCGCCGTCCGGGCCGGCCGGCTCGGCCTCCCCGACAGCGTCACCCTGCTC
ATGCAGCTGCTGTGGAAGGGCGGGCTGACCGAGGTGGAGGGGCTGCTCGCCCATCTGCGC
GAGGACCCCGCCGCCACCGACCAGCTCCATGCCATCGAGGCCGCGCTCACCTGCACCTAC
CCCTGGCTCGCGGAGCGGCGGCCGGCCCCGGCGCACCACGGTGGCTCCGCCGCGACGCGG
GCGGCGGTGTGGCCGCGGGCCGGCACCGTACTCGCGGACGTGCTCACCGGCGGGCAGACC
CATGACACCGTCCGGCGGGCCGAGGAGGTGCTGCGCGAACTCCAGCTCGGGCACGACCCG
GCGTGCCAGGAGCAGGCCGGGCTGTTCGCCCTGCTCGCGCTGGTCTACGGCGGCCGGATC
GACCTGGCGTCCGCATGGTGCGAGGGGGCGCTCGGCGAGACCGGCGCGGGGCCGCACGTC
CCGATGCGGCAGGCGGTGCTGGCGGCGGCCAGGTCGGAGATCGCGCTGCGCCGAGGTGAC
CTCGCCGAGGCCGCGGAGCGGTCCCGGGCCGCCCTCACCCACGCCTCTCCCGGCGCCTGG
GGTGTCGCGGTCGGGCTGCCGCTCGGCTCCCTGATCCTGGCGTGTACGCGGATGGGCCGG
CACGAGGAGGCGGGGTTCCACGTCGCGCAGACCGTGCCCAACGCCATGTTCAAAAGCTCC
TACGGGCTGCACTACCTGTACGCGCGCGGCCACTACTTCCTGGCGGCCGGCCGGCACCAG
GCCGCGCTCGCGGACTTTCTGCTGTGCGGCGAGCTGCTCACCGACTGGGGGCTGAGCAGC
GGCTGCGACCCGGTGCCATGGCGGATCGGCGCGGCGGAGGCATGGCTCGCGCAGGGCAAC
CACGACCAGGCCCGGATCCTGGTCTACCAGCAGCTCAGCCGTCCGCATACGGACGGCGCC
CGGGCCCGCGGGCAGTCCTTGCGCCTCCTGGCCGCCACCAGCTCGGCCAAGCGGCGGCCG
CAGCTGCTCAACGAGGCGGTGGGCCTGTTCACCGAGCAGGAGGACAAGTACGAGCTGGCT
CGCACGCTGTGGGACCTCAGCCAGGCGTACCACGCGCTCGGCGAGAAGAAGCAGGCCCGC
CGGACCATGCGCCGGGCCTGGCATGTGGCGAAGATGTGCGACGCCGCGTCGCTGTACGAG
GAGTGGCTGCCGGCCGACGACCAGTCCCAGGCCGTGGCGCCGGCTCCGAAGGCGGACGCC
GGGATCGAGCGGTTGACGCACTCCGAACGGCGTGTCGCGTCGCTGGCCGCCATGGGCTAC
ACCAACCGGGAGATCGCCGGGAAGCTGTATGTCACGGCCAGCACGGTGGAGCAGCATCTG
ACCCGGGTCTTCCGCAAGCTGGACATCAAGCACCGGGAGCAGCTGCCCACCGAACTCTAC
GCGGACCGCATGGAGTTGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [879-906]  PS00622
PS00622   HTH_LUXR_1
 [858-923]  15.45 PS50043
PS50043   HTH_LUXR_2
 [863-915]  3.7e-11 PF00196
PF00196   GerE
 [862-919]  1.4e-17 SM00421
SM00421   helix_turn_helix, Lux Regulon
 [865-879]  7.3e-09 PR00038 [879-895]  7.3e-09 PR00038 [895-907]  7.3e-09 PR00038
PR00038   HTHLUXR
IPR011990 Tetratricopeptide-like helical (Domain)
 [681-872]  3.7e-12 G3DSA:1.25.40.10
G3DSA:1.25.40.10   no description
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [873-915]  5e-16 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [843-924]  1.7e-15 SSF46894
SSF46894   C-terminal effector domain of the bipartite response regulators
IPR018130 Ribosomal protein S2, conserved site (Conserved_site)
 [18-29]  PS00962
PS00962   RIBOSOMAL_S2_1
SignalP No significant hit
TMHMM No significant hit