close all open/close all

CDS information : Gelda_00110


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction32,124 / 31,060 / - [in whole cluster]
22,724 / 21,660 / - [in contig]
Locationcomplement(31060..32124) [in whole cluster]
complement(21660..22724) [in contig]
TypeCDS
Length1,065 bp (354 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative aminodehydroquinate synthase
Product (GenBank)GdmO
Gene
Gene (GenBank)gdmO
EC number4.2.3.-
Keyword
  • AHBA
Note
Note (GenBank)
  • putative aminoDHQ synthase; hbmO
Reference
ACC
PmId
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
Related Reference
ACC
O52549
NITE
Rifam_00280
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
ACC
P0A4Z4
PmId
[17586643] Functional characterization by genetic complementation of aroB-encoded dehydroquinate synthase from Mycobacterium tuberculosis H37Rv and its heterologous expression and purification. (J Bacteriol. , 2007)
[1910148] The Mycobacterium tuberculosis shikimate pathway genes: evolutionary relationship between biosynthetic and catabolic 3-dehydroquinases. (Mol Gen Genet. , 1991)
ACC
Q84G12
NITE
Gelda2_00200
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)

close this sectionSequence

selected fasta
>putative aminodehydroquinate synthase [GdmO]
MTTSTSSPAASSAAPFRQVTVALAERSYTVHIGHGVRRLLPRVVSALGARKAVVVTARPP
EQTPDPKVPSLVVSTRDGEEAKDLAAVTDLCRRFVEFGLTRSDVVVSCGGGTTTDTVGLA
AALYHRGTPVVHVPTSLLAQVDASVGGKTAVNLPEGKNLVGAYWQPAAVLCDLDHLTTLP
EREWRNGLGEIARCHFIGAPDLDGLPLLDQIAASVTLKAGIVAADERDAGLRHILNYGHT
LGHALERATGFALRHGEGVAIGTVFAGRLAGALGRIGPERVAEHHDVVARYGLPTALPAQ
VPVAELVELMRLDKKATDGLTFVLDGPDGPGLVPGIPEDTVSATLAAMPREPAG
selected fasta
>putative aminodehydroquinate synthase [GdmO]
TTGACCACGTCGACCTCCAGTCCGGCCGCCAGTTCCGCCGCTCCTTTCCGGCAGGTCACC
GTCGCGCTGGCCGAGCGCTCGTACACCGTCCACATCGGACACGGTGTGCGGCGGCTGCTC
CCGAGGGTGGTGTCCGCCCTGGGCGCGCGCAAGGCGGTGGTGGTCACCGCGCGGCCCCCG
GAGCAGACGCCCGACCCCAAAGTGCCCTCGCTCGTCGTGTCCACGCGCGACGGGGAGGAG
GCCAAGGACCTGGCCGCCGTGACGGACCTGTGCCGCCGGTTCGTCGAATTCGGGCTGACC
CGCTCGGATGTGGTGGTGTCCTGTGGCGGCGGCACCACGACCGACACGGTGGGCCTGGCC
GCCGCCCTCTACCACCGGGGCACACCGGTCGTCCATGTGCCGACCTCGCTGCTGGCCCAG
GTGGACGCGAGCGTCGGCGGGAAGACGGCGGTGAATCTGCCCGAGGGCAAGAACCTGGTC
GGCGCCTACTGGCAGCCCGCGGCCGTGCTCTGCGACCTCGATCACCTCACCACCCTGCCC
GAACGGGAGTGGCGCAACGGCCTCGGTGAGATCGCCCGCTGCCACTTCATCGGCGCGCCC
GATCTCGACGGGCTGCCGCTGCTCGACCAGATCGCGGCCAGTGTGACGCTCAAGGCGGGC
ATCGTCGCCGCGGACGAACGCGACGCGGGCTTGCGGCACATCCTCAACTACGGACACACA
CTGGGGCATGCGCTGGAACGTGCCACGGGGTTCGCCCTGCGGCACGGGGAGGGCGTGGCC
ATCGGCACGGTCTTCGCCGGCCGGCTCGCCGGTGCGCTGGGCCGTATCGGCCCGGAGCGG
GTGGCCGAGCACCATGATGTGGTCGCCCGTTACGGCCTGCCGACCGCGCTGCCCGCCCAG
GTCCCCGTGGCCGAGCTGGTGGAGCTGATGCGTCTGGACAAGAAGGCCACCGACGGGCTG
ACGTTCGTCCTGGACGGCCCCGACGGGCCCGGACTGGTGCCCGGGATCCCCGAGGACACC
GTCAGCGCCACCCTCGCCGCGATGCCCCGCGAGCCGGCGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016037 3-dehydroquinate synthase AroB (Family)
 [17-347]  30.626 MF_00110
MF_00110   DHQ_synthase
SignalP
 [1-24]  0.54 Signal
Bacteria, Gram-positive   
 [1-24]  0.649 Signal
Bacteria, Gram-negative   
 [1-24]  0.136 Signal
Eukaryota   
TMHMM No significant hit