close all open/close all

CDS information : Gelda_00115


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction32,394 / 32,200 / - [in whole cluster]
22,994 / 22,800 / - [in contig]
Locationcomplement(32200..32394) [in whole cluster]
complement(22800..22994) [in contig]
TypeCDS
Length195 bp (64 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)
GenegdmFdx
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[21682254] The missing C-17 O-methyltransferase in geldanamycin biosynthesis. (Org Lett. , 2011)
Related Reference
ACC
P18325
PmId
[1846297] Ferredoxins from two sulfonylurea herbicide monooxygenase systems in Streptomyces griseolus. (Biochemistry. , 1991)

close this sectionSequence

selected fasta
>putative ferredoxin
MKVSVDQEKCCAAGHCALAAPEVFDQREEDGAVVLLDPRPPLALRDGVAEASFLCPAAAI
AVED
selected fasta
>putative ferredoxin
GTGAAGGTCTCGGTGGATCAGGAGAAGTGCTGTGCGGCCGGCCACTGCGCGCTGGCGGCC
CCGGAGGTGTTCGACCAGCGGGAGGAGGACGGGGCCGTTGTCCTGCTGGACCCGCGTCCG
CCGCTCGCGCTGCGTGACGGCGTCGCCGAGGCGTCGTTCCTGTGCCCGGCCGCCGCGATC
GCCGTCGAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001080 3Fe-4S ferredoxin (Family)
 [5-16]  3.3e-06 PR00352 [16-26]  3.3e-06 PR00352 [48-60]  3.3e-06 PR00352
PR00352   3FE4SFRDOXIN
SignalP No significant hit
TMHMM No significant hit