close all open/close all

CDS information : Gelda_00120


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction33,657 / 32,455 / - [in whole cluster]
24,257 / 23,055 / - [in contig]
Locationcomplement(32455..33657) [in whole cluster]
complement(23055..24257) [in contig]
TypeCDS
Length1,203 bp (400 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)GdmP
Gene
Gene (GenBank)gdmP
EC number
Keyword
  • C-4,5 desaturation
Note
Note (GenBank)
  • P450; PikC subfamily; hbmP
Reference
ACC
PmId
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
[21979086] Novel 4,5-dihydro-thiazinogeldanamycin in a gdmP mutant strain of Streptomyces hygroscopicus 17997. (Biosci Biotechnol Biochem. , 2011)
[22849774] Identification of 4,5-dihydro-4-hydroxygeldanamycins as shunt products of geldanamycin biosynthesis. (J Nat Prod. , 2012)
[23656556] 19-[(1'S,4'R)-4'-Hydroxy-1'-methoxy-2'-oxopentyl]geldanamycin, a natural geldanamycin analogue from Streptomyces hygroscopicus 17997. (J Nat Prod. , 2013)
Related Reference
ACC
Q84G11
NITE
Gelda2_00210
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)

close this sectionSequence

selected fasta
>cytochrome P450 [GdmP]
MDRTDEIRGYPELRAAACPFSPPPGYEELRERSAVTRVRMWDGSTPFLVTGYHEARAVLG
DSRFSADGTHKGMPRFTKFEVPAEVFNLGRMDDPEHARIRRMLTAHSTIRRTEAMRPMIQ
GIVDGLLDRLIAEGPPADLVADFAFPLPSQVIAVMLGVSDADFAEFQRASQGVMDFTVST
EEMGAALGVMVDYVSRMCAAKRAAPGDDLLSRLIVDQELTGGLTQQQVVATALVLLLAGH
ETTANMIALSGVLLLRHPEQLARLRADPGLMPNAVDELLRYITIVQEGTGRVAAEDVEVG
GVLIPAGEGVIINLPSANRDPHFADAHELDLGRPNAREHIGFGFGVHQCLGQTLARVELQ
IALETLLRRLPALRLEVPLDDLAFLYESMNFGVARVPVAW
selected fasta
>cytochrome P450 [GdmP]
ATGGACAGGACTGACGAGATACGCGGCTACCCCGAATTGCGGGCTGCTGCATGCCCGTTC
TCACCCCCTCCGGGTTACGAGGAACTGCGTGAGCGGTCCGCCGTCACCCGGGTGCGGATG
TGGGACGGCAGCACCCCCTTTCTCGTCACCGGCTATCACGAGGCGCGGGCCGTGCTCGGC
GACAGTAGGTTCAGCGCCGACGGCACGCACAAGGGGATGCCACGCTTCACCAAGTTCGAG
GTGCCGGCCGAGGTGTTCAACCTCGGGAGGATGGACGATCCGGAGCACGCCCGGATCCGC
CGCATGCTCACCGCGCACTCCACCATCCGGCGCACCGAGGCGATGCGGCCGATGATCCAG
GGCATCGTCGACGGCCTCCTGGACCGGCTGATCGCCGAGGGGCCGCCGGCCGACCTGGTG
GCCGACTTCGCCTTCCCCCTGCCGTCCCAGGTGATCGCCGTGATGCTGGGGGTCTCGGAC
GCCGACTTCGCGGAGTTCCAGCGGGCCTCGCAGGGCGTCATGGACTTCACGGTGTCGACG
GAGGAGATGGGCGCCGCGCTCGGCGTCATGGTCGACTACGTCAGCCGGATGTGTGCGGCC
AAGCGCGCCGCGCCGGGAGACGACCTCCTCAGCCGGCTCATCGTCGACCAGGAGCTGACG
GGCGGGCTGACCCAGCAGCAGGTGGTCGCCACCGCCCTGGTGCTGCTGCTGGCCGGCCAC
GAGACCACGGCCAACATGATCGCCCTGTCCGGCGTCCTGCTGCTGCGCCACCCCGAGCAG
CTCGCCCGGCTGCGGGCGGATCCCGGGCTGATGCCCAACGCGGTGGACGAACTGCTCCGG
TACATCACGATCGTCCAGGAGGGCACCGGACGGGTGGCCGCCGAGGATGTCGAGGTCGGC
GGGGTGCTCATCCCGGCGGGCGAAGGGGTGATCATCAACCTGCCCAGCGCCAACCGCGAT
CCCCACTTCGCGGACGCCCACGAACTGGACCTGGGCCGGCCGAACGCCCGTGAGCACATC
GGGTTCGGCTTCGGTGTGCACCAGTGCCTGGGGCAGACCCTCGCCCGGGTCGAGCTCCAG
ATCGCCCTGGAGACCCTGCTGCGCCGACTTCCGGCGCTGCGCCTGGAGGTCCCGCTCGAC
GACCTGGCGTTTCTGTACGAGTCGATGAACTTCGGCGTCGCCCGTGTGCCCGTCGCCTGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [207-266]  9.20000000000002e-06 PF00067 [271-370]  9.60000000000003e-21 PF00067
PF00067   p450
 [238-255]  1.60000065022528e-06 PR00385 [273-284]  1.60000065022528e-06 PR00385 [340-349]  1.60000065022528e-06 PR00385 [349-360]  1.60000065022528e-06 PR00385
PR00385   P450
 [3-400]  1.79999754022378e-92 SSF48264
SSF48264   Cytochrome_P450
 [20-400]  4.49999999999996e-100 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [91-102]  4.30000170645869e-49 PR00359 [138-154]  4.30000170645869e-49 PR00359 [155-170]  4.30000170645869e-49 PR00359 [192-214]  4.30000170645869e-49 PR00359 [273-284]  4.30000170645869e-49 PR00359 [291-318]  4.30000170645869e-49 PR00359 [340-349]  4.30000170645869e-49 PR00359 [349-360]  4.30000170645869e-49 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [342-351]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit