close all open/close all
Gelda_00120 Gelda_00120   last last

CDS information : Gelda_00130


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction36,696 / 33,790 / - [in whole cluster]
27,296 / 24,390 / - [in contig]
Locationcomplement(33790..36696) [in whole cluster]
complement(24390..27296) [in contig]
TypeCDS
Length2,907 bp (968 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional activator
Product (GenBank)GdmRI
Gene
Gene (GenBank)gdmRI
EC number
Keyword
Note
Note (GenBank)
  • putative transcriptional regulator
Reference
ACC
PmId
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
Related Reference
ACC
Q84G10
NITE
Gelda2_00220
PmId
[12586396] Cloning and characterization of a gene cluster for geldanamycin production in Streptomyces hygroscopicus NRRL 3602. (FEMS Microbiol Lett. , 2003)

close this sectionSequence

selected fasta
>LuxR family transcriptional activator [GdmRI]
MTAEINSSLRRNPPQRGLMSMGLTDYQSRLRDVLGTAARGNGGLLQVVGGPGVGKATLLS
SLEEQAAESDAVCLTASGFAEDTAIPFNIVEQLIRSSAAMGELDVVARWRTAGERYSEAE
HGMLAMLVREISDVLHRIAGGKQLVIAVDDVEHVDYPSLMCLLHIARHASGTRTLVAMSS
GRTHHLCARVQGFHNLYKVEIGTLSESGVVRLLERHADADLADRIGASCHAISGGNPRLV
RALLHDHLMSAPDGSEREVTVGAEFRDSYRWSLLCHPSLLQMAQILAVLGPYGSPRRVAG
LLECGEERAARAIDVLDSAGLLEDGCFRHPAARSVALETLAVEERARLGAKAAELLYADG
ADPIAVAELLVTAGKTPDHKGVAVLWHAAQKNLDEGRTEEAVAGLRLAARADLGRRERLD
IRMALVGALWAGNPAAAEPELDRLMAAIRTESPADIPEQYLCFLLFMVLWFGRFSDVEEA
FTWLSGSGGSGNASSMAALRVTRQWVTFLKPTLIHHFPDQDPSDREVDGLWAANLEHGLQ
LSVDELGMEIGHLQDPRQMADFSPDTMHLLSHSNHFWFAYAYACRIVWALAARGETEAAD
RLCGALFTAADKLNMKTPCAVALSMRAYIQCRQGDFTSAIDLAGTALRSIPPRGWGVAIG
LPLSVLVAAHTAIGRLDEAQRYLRYWVPKEMFDSVVGLEYLRARGQYCLATNRPYAALND
FMVSGMLIDQWPVDFGDLAPWRIDAAEAYLHVHEPVEAKRLALEELKLSPDRPMSTRGRA
LRVLAMAEDPDKRRLLLYQSVKCLREHGDRYGLARTLVELSRDFLSTGETQQARATWHEA
QKLMDECGMSAQHESRRDPVMGGAESPADPQPPGNSEDSGEPGVPEDTALGTSAEDAEPP
VLSEAEWRVATLAASRMTNRQIAKSLYITVSTVEQHLTRVYRKLSVGNRQDLSRRLWPLI
GATGSSSC
selected fasta
>LuxR family transcriptional activator [GdmRI]
ATGACCGCGGAGATCAACTCATCGCTCAGACGCAACCCCCCACAGCGAGGACTGATGAGT
ATGGGACTGACAGATTATCAATCGAGGCTCCGCGACGTTCTCGGCACGGCAGCAAGGGGA
AACGGTGGGCTGCTCCAGGTGGTCGGGGGACCCGGAGTCGGGAAGGCCACCTTATTGAGC
AGTCTGGAGGAGCAGGCGGCCGAGTCGGACGCGGTCTGTCTTACGGCGTCCGGATTCGCG
GAAGACACCGCCATCCCCTTCAATATCGTGGAACAGCTGATCCGATCCTCCGCGGCCATG
GGGGAATTGGACGTCGTGGCGCGCTGGCGGACCGCGGGGGAGCGGTATTCGGAAGCCGAA
CACGGCATGCTGGCCATGCTGGTCCGTGAAATATCGGATGTGCTGCACCGCATCGCGGGC
GGCAAACAACTGGTCATCGCGGTCGATGACGTCGAGCATGTCGACTACCCCTCCCTCATG
TGCCTTCTGCATATCGCCAGACATGCGTCCGGCACCCGTACGCTCGTCGCGATGTCCAGC
GGGCGGACACATCATCTGTGCGCCCGTGTGCAGGGATTCCACAACCTCTACAAGGTGGAG
ATCGGCACACTTTCCGAGTCCGGGGTCGTGCGTCTGCTGGAGCGGCACGCCGACGCCGAC
CTGGCGGACCGGATCGGCGCCTCCTGTCACGCCATCAGCGGTGGCAATCCAAGGCTGGTG
AGGGCGCTGCTGCACGACCATCTCATGTCCGCTCCGGACGGATCGGAAAGAGAGGTCACG
GTCGGAGCGGAGTTCCGGGATTCCTATCGCTGGAGCCTGTTATGCCATCCGTCGCTGCTC
CAGATGGCACAGATCCTCGCCGTACTGGGCCCGTACGGCAGCCCGCGGCGGGTGGCCGGT
CTGCTCGAATGCGGTGAGGAGCGCGCGGCCCGGGCCATCGATGTCCTCGACTCCGCAGGG
CTCCTGGAGGACGGGTGCTTCCGGCACCCCGCGGCCCGATCCGTCGCGCTGGAAACGCTG
GCGGTGGAGGAGCGGGCCCGCCTCGGCGCGAAGGCGGCCGAACTTCTGTATGCCGACGGG
GCCGACCCGATCGCGGTCGCGGAACTCCTGGTCACCGCCGGTAAGACGCCTGATCACAAG
GGTGTGGCGGTGCTCTGGCACGCGGCCCAGAAGAATCTCGACGAGGGCCGTACGGAAGAA
GCGGTCGCCGGTCTGCGGCTGGCCGCTCGCGCCGATCTCGGCCGGCGGGAGCGCCTGGAC
ATTCGCATGGCGCTGGTCGGCGCGTTATGGGCCGGCAATCCGGCGGCCGCCGAACCCGAG
CTCGACCGGCTGATGGCCGCGATACGGACCGAATCCCCCGCGGACATCCCCGAGCAGTAT
CTGTGCTTCCTGCTCTTCATGGTGCTGTGGTTCGGCCGGTTCAGCGATGTCGAAGAAGCC
TTCACATGGCTGTCGGGCAGTGGTGGCTCCGGTAATGCGTCCAGTATGGCGGCGCTGCGG
GTGACCCGGCAGTGGGTCACCTTCCTCAAACCGACGCTGATCCACCACTTCCCCGACCAG
GATCCCTCGGACAGGGAAGTCGACGGGCTGTGGGCGGCCAATCTGGAGCACGGACTCCAG
CTCTCCGTGGACGAACTGGGCATGGAGATCGGGCATCTCCAGGATCCCCGGCAGATGGCG
GACTTCTCCCCCGACACCATGCACCTGTTGTCGCACTCCAACCATTTCTGGTTCGCCTAC
GCGTACGCCTGCCGGATCGTCTGGGCACTGGCCGCGAGGGGAGAGACGGAGGCGGCGGAC
CGGCTGTGCGGGGCGCTGTTCACCGCGGCGGACAAGCTCAATATGAAGACGCCGTGTGCC
GTCGCCCTGTCCATGCGTGCCTATATCCAGTGCCGCCAGGGGGACTTCACCTCGGCCATC
GATCTCGCCGGCACCGCGCTGAGGTCCATCCCGCCACGCGGCTGGGGCGTCGCCATCGGG
TTACCGCTGTCCGTGCTGGTGGCGGCCCACACCGCCATCGGCAGGCTGGACGAGGCCCAG
CGGTATCTGCGTTACTGGGTGCCGAAGGAGATGTTCGACAGCGTTGTCGGATTGGAGTAC
CTCCGGGCCCGGGGGCAATACTGCCTGGCCACCAACCGCCCCTATGCCGCGCTGAACGAT
TTCATGGTGAGCGGGATGCTGATCGACCAGTGGCCCGTGGACTTCGGTGATCTGGCACCC
TGGCGCATCGACGCCGCCGAGGCATATCTGCACGTACATGAACCCGTGGAGGCCAAAAGG
CTCGCCCTGGAAGAGCTCAAGCTGTCGCCCGACCGCCCCATGAGCACCCGCGGCAGAGCG
CTGCGCGTACTGGCCATGGCGGAGGACCCGGACAAACGCAGGCTGCTGCTCTACCAATCC
GTCAAGTGCCTGCGCGAGCACGGCGACCGTTATGGACTCGCCCGCACGCTCGTCGAACTC
AGCCGGGACTTCCTCAGCACCGGGGAAACCCAGCAGGCGCGCGCCACCTGGCATGAGGCG
CAGAAGCTGATGGACGAGTGCGGAATGAGCGCCCAGCACGAGAGCCGACGGGACCCCGTC
ATGGGCGGTGCCGAGAGCCCGGCGGACCCTCAACCGCCGGGAAATTCCGAGGATTCCGGG
GAGCCCGGGGTACCCGAGGATACGGCCCTGGGCACATCGGCCGAAGATGCCGAGCCACCC
GTACTTTCGGAGGCCGAATGGCGCGTGGCCACCCTCGCGGCGTCGAGAATGACCAACCGG
CAGATCGCCAAGAGCCTCTACATCACCGTCAGCACCGTGGAGCAGCATCTGACCCGCGTC
TACCGCAAGCTCTCCGTGGGAAATCGACAGGATCTGTCGCGCCGCCTGTGGCCGCTCATA
GGAGCCACCGGATCGTCCTCCTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [900-953]  6.1e-11 PF00196
PF00196   GerE
 [895-960]  PS50043
PS50043   HTH_LUXR_2
 [899-956]  1.20000117458134e-17 SM00421
SM00421   HTH_LUXR
IPR011990 Tetratricopeptide-like helical (Domain)
 [589-858]  1.1e-14 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [896-955]  3.7e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [880-959]  1.29999924468179e-14 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit
Gelda_00120 Gelda_00120   last last