close all open/close all

CDS information : Gelda_00140


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction8,901 / 8,551 / - [in whole cluster]
1 / 351 / + [in contig]
Locationcomplement(8551..8901) [in whole cluster]
1..351 [in contig]
TypeCDS
Length351 bp (116 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein(fragment)
Product (GenBank)putative oxidoreductase
Gene
Gene (GenBank)gdnQ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC

close this sectionSequence

selected fasta
>hypothetical protein(fragment) [putative oxidoreductase]
AARSVTLPATHTPDTSVRPVASDGMCSPPPLGCSTGRSPSPARRPACATIRGATASASRS
TTPPSPSRTPTRRSSTISKDATSPSTTRMPRAASCSASSPDGDGRVWGKKVTSSLH
selected fasta
>hypothetical protein(fragment) [putative oxidoreductase]
GCCGCCAGATCGGTGACATTGCCCGCGACCCACACCCCGGACACCTCGGTGCGCCCGGTC
GCGTCGGACGGGATGTGCTCACCGCCGCCGCTCGGATGCTCCACCGGCCGCAGCCCGAGC
CCCGCCAGGAGACCGGCGTGTGCCACCATCCGCGGCGCGACGGCCAGCGCCTCGCGCTCG
ACCACGCCGCCGTCGCCCAGCCGCACGCCGACGAGGCGGTCCTCGACGATCTCCAAGGAC
GCCACCTCGCCGTCCACCACACGGATGCCACGGGCGGCCAGCTGCTCCGCCTCCTCGCCG
GACGGCGACGGCAGGGTGTGGGGGAAGAAGGTGACATCGTCGCTCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit