close all open/close all

CDS information : Gelda_00150


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction7,666 / 6,845 / - [in whole cluster]
1,236 / 2,057 / + [in contig]
Locationcomplement(6845..7666) [in whole cluster]
1236..2057 [in contig]
TypeCDS
Length822 bp (273 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative integral-membrane protein
Gene
Gene (GenBank)gndM
EC number
Keyword
Note
Note (GenBank)
  • GdnM
Reference
ACC
Related Reference
ACC
Q49BB7
NITE
Gelda2_00320

close this sectionSequence

selected fasta
>hypothetical protein [putative integral-membrane protein]
MGSCGGGPRAALVIGVMKIEPSLRIPATAGTMAAMSAGPPFRLARAAVFAAMCVVVTALG
HVLMSGDRLPVWAVAAAFAGTAAGAWWVAGREHGALAVTGATVVAQFGLHMAFRFAETAV
APAAGSAMGDGMSGMRGGMGAAPMSGAAMGHMHDGMGHMRHGADAISSAAPSMSHLPWPW
AGPGGAGMATAHLLAALICGLWLWRGERAAFRLGRALAALLFVPLVLALRILGAGVTPPP
AWTSAPAVARRPRGVLLRHVILRRGPPRRFAIR
selected fasta
>hypothetical protein [putative integral-membrane protein]
ATGGGGTCATGTGGCGGCGGTCCACGAGCCGCGCTTGTCATCGGCGTGATGAAGATTGAG
CCATCGTTACGCATACCGGCAACGGCTGGCACCATGGCTGCCATGTCCGCCGGGCCGCCC
TTCCGTCTCGCACGAGCCGCCGTGTTCGCGGCGATGTGCGTCGTGGTGACGGCGCTCGGA
CACGTGCTGATGTCCGGTGACAGGCTGCCGGTGTGGGCCGTGGCCGCCGCCTTCGCCGGA
ACGGCGGCCGGTGCGTGGTGGGTTGCGGGGCGGGAGCACGGTGCGCTGGCCGTGACCGGG
GCGACCGTGGTCGCGCAATTCGGCCTCCATATGGCCTTCCGGTTCGCGGAGACGGCAGTC
GCCCCAGCGGCGGGAAGCGCCATGGGTGACGGGATGTCCGGTATGCGGGGCGGCATGGGC
GCCGCCCCGATGAGCGGCGCCGCCATGGGTCATATGCACGATGGCATGGGCCATATGCGC
CATGGCGCGGACGCGATCTCCTCCGCCGCGCCGTCCATGAGTCATCTGCCGTGGCCCTGG
GCGGGTCCGGGCGGGGCGGGCATGGCCACGGCCCACCTGCTCGCCGCCCTGATCTGCGGG
CTGTGGCTGTGGCGCGGCGAACGGGCCGCCTTCCGGCTCGGCCGCGCGCTCGCGGCCCTG
CTGTTCGTCCCGCTCGTCCTCGCCCTGCGCATCCTGGGCGCGGGTGTCACTCCGCCGCCC
GCATGGACCTCCGCACCGGCCGTCGCCCGCCGGCCGCGCGGAGTCCTGCTGCGGCACGTC
ATCCTGCGCAGAGGGCCACCGAGGCGGTTCGCCATCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [41-63]  Transmembrane (o-i) [70-89]  Transmembrane (i-o) [182-204]  Transmembrane (o-i) [211-233]  Transmembrane (i-o)
Transmembrane 4