close all open/close all

CDS information : Gelda_00160


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction6,661 / 6,029 / - [in whole cluster]
2,241 / 2,873 / + [in contig]
Locationcomplement(6029..6661) [in whole cluster]
2241..2873 [in contig]
TypeCDS
Length633 bp (210 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative RNA polymerase ECF-type sigma factor
Product (GenBank)putative ECF-family sigma factor
Gene
Gene (GenBank)gdnS
EC number
Keyword
Note
Note (GenBank)
  • GdnS
Reference
ACC
PmId
[16502293] Identification of AHBA biosynthetic genes related to geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Curr Microbiol. , 2006)
Related Reference
ACC
P66809
PmId
[10027986] Differential expression of 10 sigma factor genes in Mycobacterium tuberculosis. (Mol Microbiol. , 1999)
[15049808] Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. (Mol Microbiol. , 2004)
ACC
Q49BB8
NITE
Gelda2_00310

close this sectionSequence

selected fasta
>putative RNA polymerase ECF-type sigma factor [putative ECF-family sigma factor]
MPSATLPAAPIRAVHGLATAANDHQVTEWALAARDGDREAVDHFIRATYRDVRRFVLHLS
ADPHGCEDLAQETYLRALTGLPRFAGRSSARTWLLSIARRVVVDRYRTAAARPRTLDADD
WQEAAERAQPAGLPGFDEGVALMDLLAALAPARREMFLLTKVLGLPYADAATATGCPIGT
VRSRVARAREDISALLAAAEKAAGPVPLVG
selected fasta
>putative RNA polymerase ECF-type sigma factor [putative ECF-family sigma factor]
ATGCCTTCTGCCACGCTGCCCGCCGCACCGATAAGAGCCGTGCACGGCCTTGCCACCGCG
GCGAACGACCACCAGGTCACCGAATGGGCGCTGGCCGCCCGGGACGGCGACCGCGAGGCG
GTCGACCACTTCATCCGCGCCACCTACCGCGATGTGCGCCGTTTCGTGCTCCACCTCAGC
GCCGATCCGCATGGTTGTGAGGACCTCGCCCAGGAGACGTATCTGCGGGCGCTGACCGGG
CTGCCGCGCTTCGCCGGTCGCTCATCGGCCCGGACGTGGCTGCTGTCGATCGCCCGCCGT
GTGGTCGTCGACCGCTACCGCACGGCCGCCGCCCGTCCCCGTACGTTGGACGCGGACGAC
TGGCAGGAGGCGGCCGAACGGGCGCAGCCCGCCGGGCTCCCCGGGTTCGACGAGGGGGTG
GCGCTGATGGACCTGCTGGCGGCGCTCGCCCCGGCACGCCGTGAGATGTTCCTCCTCACC
AAGGTGCTCGGCCTGCCGTACGCGGACGCCGCGACCGCGACCGGCTGCCCCATCGGCACC
GTACGCTCGCGCGTGGCCCGCGCCCGTGAGGACATCTCCGCGCTGCTGGCCGCGGCCGAG
AAGGCCGCGGGACCGGTGCCGTTGGTGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007627 RNA polymerase sigma-70 region 2 (Domain)
 [45-110]  2e-14 PF04542
PF04542   Sigma70_r2
IPR013249 RNA polymerase sigma factor 70, region 4 type 2 (Domain)
 [141-191]  3.5e-14 PF08281
PF08281   Sigma70_r4_2
IPR013324 RNA polymerase sigma factor, region 3/4 (Domain)
 [131-198]  6.899999633797e-10 SSF88659
SSF88659   Sigma_r3_r4
IPR013325 RNA polymerase sigma factor, region 2 (Domain)
 [18-130]  2.70000183580794e-22 SSF88946
SSF88946   Sigma_r2
IPR014284 RNA polymerase sigma-70 (Domain)
 [39-193]  1.2e-20 TIGR02937
TIGR02937   Sigma70-ECF
SignalP No significant hit
TMHMM No significant hit