close all open/close all

CDS information : Gelda_00170


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction5,202 / 5,897 / + [in whole cluster]
3,700 / 3,005 / - [in contig]
Location5202..5897 [in whole cluster]
complement(3005..3700) [in contig]
TypeCDS
Length696 bp (231 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative hydrolase
Product (GenBank)phosphatase
Gene
Gene (GenBank)gdnP
EC number
Keyword
  • AHBA
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[16502293] Identification of AHBA biosynthetic genes related to geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Curr Microbiol. , 2006)
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
Related Reference
ACC
O52553
NITE
Rifam_00330
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
ACC
P32662
PmId
[13129953] Role of 2-phosphoglycolate phosphatase of Escherichia coli in metabolism of the 2-phosphoglycolate formed in DNA repair. (J Bacteriol. , 2003)
ACC
Q49BB9
NITE
Gelda2_00300
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)
Family/Domain
FD
IPR006439

close this sectionSequence

selected fasta
>putative hydrolase [phosphatase]
MNTHPISHGGPLSGAGVAPITSVVFDLDGVLVNSFAVMREAFTLAYAEVVGDGEPPFEEY
NRHLGRYFPDIMRIMGLPLEMEGPFVRESYRLAHLVEMFDGVPELLSELRHRGLRLAVAT
GKSGPRARSLLDTLGIRGQFHVVLGSDEVARPKPAPDIVLKAMDMMDADPDRTVMVGDAV
TDLASARGAGITAVAAMWGETDEKTLLAAEPDVILHKPAELLSLCPEVTVP
selected fasta
>putative hydrolase [phosphatase]
ATGAACACCCATCCGATCAGTCATGGCGGCCCGCTCTCCGGCGCGGGTGTCGCCCCCATC
ACCTCGGTGGTCTTCGACCTCGACGGTGTCCTCGTCAACAGCTTCGCGGTGATGCGCGAG
GCGTTCACCCTCGCCTACGCCGAGGTCGTCGGCGACGGTGAGCCACCCTTCGAGGAGTAC
AACCGGCATCTGGGCCGCTACTTCCCCGACATCATGCGGATCATGGGTCTTCCGCTGGAG
ATGGAGGGCCCGTTCGTCCGCGAGAGCTACCGGCTCGCCCACCTGGTGGAGATGTTCGAC
GGTGTGCCAGAGCTGCTGTCGGAGCTGCGCCACCGCGGGTTACGACTCGCCGTGGCCACC
GGGAAGAGCGGACCCCGGGCGCGTTCGCTGCTCGACACCCTCGGCATCCGTGGGCAGTTC
CACGTGGTCCTCGGCTCGGACGAGGTGGCCCGGCCCAAGCCCGCGCCGGACATCGTGCTG
AAGGCGATGGACATGATGGACGCGGACCCCGACCGGACCGTGATGGTCGGGGACGCGGTG
ACCGACCTGGCCAGCGCGCGGGGGGCCGGGATCACCGCCGTGGCCGCGATGTGGGGTGAG
ACCGACGAGAAGACCCTGCTCGCGGCGGAGCCCGATGTGATCCTGCACAAGCCGGCGGAA
CTGCTGTCGCTGTGCCCCGAGGTGACGGTTCCATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005833 Haloacid dehalogenase/epoxide hydrolase (Family)
 [20-31]  1.2e-07 PR00413 [109-122]  1.2e-07 PR00413 [140-156]  1.2e-07 PR00413 [158-178]  1.2e-07 PR00413
PR00413   HADHALOGNASE
IPR006351 3-amino-5-hydroxybenzoic acid synthesis-related (Family)
 [23-226]  9.9e-108 TIGR01454
TIGR01454   AHBA_synth_RP: AHBA synthesis associated protein
IPR006402 HAD-superfamily hydrolase, subfamily IA, variant 3 (Family)
 [131-194]  3.2e-08 TIGR01509
TIGR01509   HAD-SF-IA-v3: HAD hydrolase, family IA, variant 3
IPR006439 HAD-superfamily hydrolase, subfamily IA, variant 1 (Family)
 [102-190]  1e-08 TIGR01549
TIGR01549   HAD-SF-IA-v1: HAD hydrolase, family IA, variant 1
IPR023214 HAD-like domain (Domain)
 [90-223]  1.2e-39 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   no description
 [19-227]  3.8e-50 SSF56784
SSF56784   HAD-like
SignalP No significant hit
TMHMM No significant hit