close all open/close all

CDS information : Gelda_00180


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction3,857 / 4,990 / + [in whole cluster]
5,045 / 3,912 / - [in contig]
Location3857..4990 [in whole cluster]
complement(3912..5045) [in contig]
TypeCDS
Length1,134 bp (377 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative UDP-glucose C-3 dehydrogenase
Product (GenBank)oxidoreductase
Gene
Gene (GenBank)gdnO
EC number
Keyword
  • AHBA
Note
Note (GenBank)
Reference
ACC
PmId
[16502293] Identification of AHBA biosynthetic genes related to geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Curr Microbiol. , 2006)
[18214443] The LuxR family members GdmRI and GdmRII are positive regulators of geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Arch Microbiol. , 2008)
Related Reference
ACC
Q7BUE1
NITE
Rifam_00320
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207504] Kanosamine biosynthesis: a likely source of the aminoshikimate pathway's nitrogen atom. (J Am Chem Soc. , 2002)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
[21081954] The biosynthesis of 3-amino-5-hydroxybenzoic acid (AHBA), the precursor of mC7N units in ansamycin and mitomycin antibiotics: a review. (J Antibiot (Tokyo). , 2011)
ACC
Q49BC0
NITE
Gelda2_00290
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)

close this sectionSequence

selected fasta
>putative UDP-glucose C-3 dehydrogenase [oxidoreductase]
MSAPSIGEPPIRTAVVGLGWAARSIWLPRLRHNPAFTVTAAVDPDERGRAAVAEAEGMDR
LPVLAAVHDLDPAEVDLAVVAVPNHLHCAVAAELLAKGIPVFLEKPVCLTSEEAERLAEA
ERSGGAMLLAGSAARYRADVRGLYRIAARLGHIRHVELAWVRSRGVPDRGGWFTQRSLAG
GGALVDLGWHLFDIAVPLLGTAAFRHAIGTVSSDFIVQRSSRAAWRGDDGDGPALLGANG
GATDVEDTARGFLITDDGRSVVLHASWASHEELDTTRVTIDGSAGSATLRCTFGFSPNRL
EKSTLTRTVDGTTRPVAVPTEPVGTEYDRQLDLLPAQLRDPAGRGRVIDEVRRTIGAIER
VYASARIHREVRESASV
selected fasta
>putative UDP-glucose C-3 dehydrogenase [oxidoreductase]
ATGAGCGCCCCGTCCATCGGCGAGCCGCCGATCAGGACCGCCGTGGTGGGGCTGGGATGG
GCGGCCCGCTCGATCTGGCTGCCCCGGCTCCGCCACAACCCCGCCTTCACCGTGACCGCC
GCGGTGGATCCCGACGAGCGCGGCCGCGCGGCCGTCGCCGAGGCGGAGGGCATGGACCGG
CTGCCGGTGCTGGCGGCCGTCCACGACCTCGACCCCGCCGAGGTGGACCTGGCGGTGGTC
GCGGTGCCCAACCATCTGCACTGTGCGGTCGCCGCCGAGCTGCTGGCCAAGGGCATTCCG
GTGTTCCTGGAGAAGCCGGTGTGCCTGACCTCCGAGGAGGCCGAGCGGCTGGCCGAAGCG
GAGCGCTCGGGCGGCGCGATGCTGCTGGCCGGCAGCGCGGCGCGGTACCGCGCCGATGTG
CGCGGGCTGTACCGGATCGCCGCCCGGCTGGGCCATATCCGTCATGTCGAGCTCGCCTGG
GTGCGGTCACGCGGCGTGCCCGACCGGGGCGGCTGGTTCACCCAGCGGTCGCTCGCGGGC
GGCGGGGCGCTGGTCGACCTGGGCTGGCATCTGTTCGACATCGCGGTTCCGCTGCTGGGC
ACCGCCGCGTTCCGGCACGCCATCGGGACCGTGTCCTCCGACTTCATCGTCCAGCGGTCC
TCCCGGGCCGCGTGGCGCGGCGACGACGGCGACGGCCCGGCGCTCCTGGGCGCCAACGGG
GGTGCCACCGATGTCGAGGACACCGCACGCGGATTCCTCATCACCGACGACGGCCGTTCG
GTCGTGCTGCACGCGAGCTGGGCCTCGCACGAGGAACTGGACACCACCCGGGTGACGATC
GACGGCAGCGCGGGCAGCGCCACCCTGCGCTGCACCTTCGGATTCAGCCCGAACCGCCTC
GAGAAGTCCACCCTGACCCGTACCGTCGACGGTACGACCCGGCCGGTGGCCGTACCCACC
GAACCGGTCGGCACCGAGTACGACCGGCAGCTCGACCTGCTTCCCGCGCAACTGCGCGAC
CCGGCCGGGCGGGGCCGGGTGATCGATGAGGTCCGCCGGACCATCGGCGCCATCGAACGG
GTCTACGCCTCGGCCCGGATCCACCGGGAGGTCCGGGAGTCGGCGTCGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [11-128]  6.79999999999998e-22 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [149-201]  3.5e-05 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [9-155]  4.40000000000001e-29 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit