close all open/close all

CDS information : Gelda_00210


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction1,927 / 1,043 / - [in whole cluster]
6,975 / 7,859 / + [in contig]
Locationcomplement(1043..1927) [in whole cluster]
6975..7859 [in contig]
TypeCDS
Length885 bp (294 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative kanosamine kinase
Product (GenBank)kinase
Gene
Gene (GenBank)gdnK
EC number
Keyword
  • AHBA
Note
Note (GenBank)
Reference
ACC
PmId
[16502293] Identification of AHBA biosynthetic genes related to geldanamycin biosynthesis in Streptomyces hygroscopicus 17997. (Curr Microbiol. , 2006)
Related Reference
ACC
O52554
NITE
Rifam_00340
PmId
[11278540] Mutational analysis and reconstituted expression of the biosynthetic genes involved in the formation of 3-amino-5-hydroxybenzoic acid, the starter unit of rifamycin biosynthesis in amycolatopsis Mediterranei S699. (J Biol Chem. , 2001)
[12207505] Characterization of the early stage aminoshikimate pathway in the formation of 3-amino-5-hydroxybenzoic acid: the RifN protein specifically converts kanosamine into kanosamine 6-phosphate. (J Am Chem Soc. , 2002)
ACC
Q49BC3
NITE
Gelda2_00260
PmId
[16085885] Insights into the biosynthesis of the benzoquinone ansamycins geldanamycin and herbimycin, obtained by gene sequencing and disruption. (Appl Environ Microbiol. , 2005)

close this sectionSequence

selected fasta
>putative kanosamine kinase [kinase]
MALRLEHDDLGISESSFRWPEPDGTDAMTSASGGATRDLDLLARHIRELCAGRPERLTGV
GVAMPATLDATGTVTAWPGRPSWAGVDLRGALSALFGHAEVRCADDGDLAALAEAHEARC
PDLLYLGVGTGIGGGIVLNGKPVPGVGRGSCEVGHLVVDRDGPLCDCGRRGCVQAAASGP
ATLRRAARRRDEEVTFTALRQAVRGGKPWAVASLRESGRALAAAVTGVCELLHPSLVLIG
GGFAAAMPELVAMVAERTAELGRPGHPPPPVRPARLGGLSSLHGAVLLARGLPD
selected fasta
>putative kanosamine kinase [kinase]
GTGGCGCTGCGCCTCGAACACGACGACCTCGGCATCAGCGAATCCTCCTTCCGCTGGCCC
GAGCCGGACGGTACGGACGCCATGACGTCCGCGTCCGGTGGCGCCACCCGCGATCTGGAC
CTGCTGGCGCGCCACATCAGGGAGCTGTGTGCGGGCCGACCCGAGCGGCTCACAGGTGTC
GGGGTCGCGATGCCCGCCACCCTCGACGCCACCGGCACGGTCACCGCCTGGCCCGGCCGT
CCCAGCTGGGCCGGAGTGGATCTGCGCGGCGCGCTGTCCGCCCTCTTCGGCCACGCCGAG
GTGCGCTGCGCCGACGACGGCGATCTGGCCGCCCTCGCCGAAGCACACGAAGCCCGCTGC
CCCGACCTGCTCTATCTCGGCGTCGGCACCGGGATAGGCGGTGGCATCGTGCTGAACGGG
AAACCCGTGCCCGGTGTGGGCCGCGGCTCCTGCGAAGTCGGCCACCTGGTCGTGGACCGC
GACGGACCGCTGTGCGACTGCGGTCGGCGCGGCTGCGTCCAGGCGGCGGCCTCGGGCCCG
GCGACCCTGCGCAGGGCGGCGCGGAGACGGGACGAGGAGGTGACCTTCACCGCGCTGCGC
CAAGCGGTGCGCGGCGGAAAGCCGTGGGCGGTGGCGTCGCTGCGGGAGAGCGGCAGGGCC
CTGGCCGCGGCCGTGACCGGCGTATGCGAACTGCTCCATCCCTCGCTCGTGCTGATCGGC
GGAGGGTTTGCCGCGGCGATGCCGGAGCTGGTGGCGATGGTGGCCGAGCGGACGGCGGAG
CTGGGGCGCCCCGGCCATCCACCGCCACCGGTCCGGCCCGCGCGACTGGGCGGGCTGTCC
TCACTGCACGGCGCCGTGCTGCTGGCCAGGGGACTGCCGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000600 ROK (Family)
 [51-181]  3e-23 PF00480
PF00480   ROK
SignalP No significant hit
TMHMM No significant hit