close all open/close all
first first   Gelda_00210 Gelda_00210

CDS information : Gelda_00220


close this sectionLocation

Organism
Strain17997
Entry nameGeldanamycin
Contig
Start / Stop / Direction880 / 29 / - [in whole cluster]
8,022 / 8,873 / + [in contig]
Locationcomplement(29..880) [in whole cluster]
8022..8873 [in contig]
TypeCDS
Length852 bp (283 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative MerR family transcriptional regulator
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)gdnT
EC number
Keyword
Note
Note (GenBank)
  • GdnT
Reference
ACC
Related Reference
ACC
Q49BC5
NITE
Gelda2_00240
Family/Domain
FD
IPR000551

close this sectionSequence

selected fasta
>putative MerR family transcriptional regulator [putative transcriptional regulator]
MSGAALGDIMFTIGDFARHGRVSVRMLRHYDAIGLLRPAHVDPATGYRHYSAAQLSRLNR
VIALKELGFTLQQVRDIVDEKVGTEELRGMLRLRRAELEATVEAVAARLVQVEARLRSIE
SEGHMPTDDVVIKRVPAVRVAELTATAASFDPQDISPVITPLYEELFRRLDAAGITPTGP
GVAYYEDAPEGGGAISVHAAVQVSAPSRDGDDLRILDLPPIDHAATIVHRGPMDAVVPTA
QALAHWIDGNGYRSTGYPREITLECPENRAEWVTELQTPVVQV
selected fasta
>putative MerR family transcriptional regulator [putative transcriptional regulator]
GTGTCAGGCGCTGCACTCGGAGACATCATGTTCACCATCGGAGACTTCGCCCGGCACGGC
CGTGTCTCGGTCCGGATGCTGCGCCACTACGACGCCATCGGACTGCTGCGCCCGGCCCAT
GTCGACCCCGCCACCGGCTACCGCCACTACTCGGCCGCCCAGCTCAGCCGCCTGAACCGG
GTCATCGCGCTCAAAGAGCTCGGCTTCACCCTCCAGCAGGTGCGGGACATCGTGGACGAG
AAGGTCGGCACCGAGGAGCTGCGCGGCATGCTGCGGTTGCGCCGGGCCGAGCTGGAAGCC
ACGGTGGAAGCCGTGGCGGCACGGCTGGTGCAGGTCGAGGCGAGGCTCCGGTCGATCGAA
AGCGAGGGGCACATGCCCACCGACGACGTCGTCATCAAGAGGGTCCCCGCGGTGCGGGTG
GCGGAGCTCACCGCGACCGCCGCCAGCTTCGACCCGCAGGACATCAGCCCGGTCATCACA
CCCCTCTACGAAGAGCTGTTCCGGCGGCTCGACGCTGCGGGCATCACCCCGACGGGCCCT
GGTGTCGCATACTACGAGGACGCCCCGGAAGGCGGCGGCGCCATCAGTGTGCACGCCGCC
GTCCAGGTGTCCGCCCCGTCACGGGACGGCGATGACCTCCGGATCCTCGATCTGCCGCCC
ATCGACCACGCCGCCACCATCGTCCACCGCGGCCCGATGGACGCCGTGGTGCCCACGGCC
CAGGCCCTGGCCCATTGGATTGACGGCAACGGCTACCGGTCGACCGGCTACCCCCGGGAG
ATCACCCTGGAGTGCCCGGAGAACCGTGCGGAATGGGTCACGGAACTCCAGACACCGGTG
GTCCAGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000551 Transcription regulator HTH, MerR (Domain)
 [10-80]  PS50937
PS50937   HTH_MERR_2
 [12-50]  4.1e-10 PF00376
PF00376   MerR
 [11-81]  1.60000240695997e-20 SM00422
SM00422   HTH_MERR
IPR009061 DNA binding domain, putative (Domain)
 [11-126]  1.50000306971104e-23 SSF46955
SSF46955   Putativ_DNA_bind
IPR010499 Bacterial transcription activator, effector binding (Domain)
 [128-281]  2.49999811956465e-17 SM00871
SM00871   AraC_E_bind
 [130-280]  2e-11 PF06445
PF06445   GyrI-like
IPR011256 Regulatory factor, effector, bacterial (Domain)
 [129-283]  1.29999924468179e-20 SSF55136
SSF55136   Bac_reg_effector
SignalP No significant hit
TMHMM No significant hit
first first   Gelda_00210 Gelda_00210