close all open/close all
first first   Gilvo_00020 Gilvo_00020

CDS information : Gilvo_00010


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction4,068 / 799 / - [in whole cluster]
4,068 / 799 / - [in contig]
Locationcomplement(799..4068) [in whole cluster]
complement(799..4068) [in contig]
TypeCDS
Length3,270 bp (1,089 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative AfsR family transcriptional regulator
Product (GenBank)putative regulatory protein
Gene
Gene (GenBank)gilS
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • GilS
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
Related Reference
ACC
P25941
PmId
[2253887] Primary structure of AfsR, a global regulatory protein for secondary metabolite formation in Streptomyces coelicolor A3(2). (Gene. , 1990)
[11952895] afsS is a target of AfsR, a transcriptional factor with ATPase activity that globally controls secondary metabolism in Streptomyces coelicolor A3(2). (Mol Microbiol. , 2002)
[17434533] AfsR recruits RNA polymerase to the afsS promoter: a model for transcriptional activation by SARPs. (J Mol Biol. , 2007)

close this sectionSequence

selected fasta
>putative AfsR family transcriptional regulator [putative regulatory protein]
MTRRGLRFGLLGTPVLYDGEGPDAPGSVQVTGSPKLRALFVALLLDAGRVVSVEALKDAL
WGGAPPVSALPSLHNHVARLRRLLDDPGRLLTVPTGYLLRVGEGEVDVQVFDAHTAAARA
AHTARDWERVARECAAALALWRGNPLAGMPPEVGGYALVRRLREARLLLLEWRYDAELAL
GGERLADLVPELAALAAEHPLRESYHRQLMLALHRTGRQAEALVVHRDLRARLADELGVE
PGPGVREAHVEVLRGQGERQEHGRCAEAAGGGGVPPRPAQLPPAPAHFTGRDAVRDELIR
VLTRAPRPAAGPPAVVVSGTAGVGKSALAVQVAHTLAERFVDGQLYVNLHGTTPGMTPLT
PAQALSALLRDLGTEPCAVPERPDAAAALLRSLLAPTRTLLVLDDAADAAQVRPLLPGGP
GCAVIVTSRSPLTTLDGAVRVPLGPLSDEDSAALLRAVSGRDGLGAGHPLVALTGRLPLA
LRVVAARLAARRALTPDDLAGQLSATDSRLPHLEYDDLSVRRSLAVAHDALTVSDRETDR
DAALALCRIGALDLPAYGAPLLARLTGTGERRAEAALDRLVDVALVEETAYGRYVPHDLV
RDFARERARAAAGPQTAPREDAALREDAVLREDAVLREDAVLREGAVLREGAVLREGAVL
REGAAPREGAAPREEAVLREDAAPREDAAPREDAGPRTGTREHPAETALRWYAAVAERAL
TAIVEPGPDQDDRRRPTPSQPPGHTAHVASVPPFDDAGAAFAWGDRELENIVTLVGRYAG
EGTGGGGDRGRHDVHIAVLLRLLHPYLLRGGRVPELEVLGRAALRVARRLGDEAAEACAL
GDLAGLHFLTGRTGEALALTDRALEIWRRLGAVSWIRRALNHRGLLLEGLGRYAESERAL
RQSLTHSRQLADPYGEAVTLSHLGNLYEHTDPRAAIDQHRRSLVIGDRIGAVIVRHSAHC
NIGYAHLRLGEPAAALPHFEESLRILAGHGDWHGESQTRLGLVRALRLLGHAGRADAECA
ELLRRADARADRYTGGLARHQYGLLLRERGRVGEAREQWRSALAALDGTDERAVVEELRG
LVAGARPAS
selected fasta
>putative AfsR family transcriptional regulator [putative regulatory protein]
GTGACACGGCGCGGACTGCGGTTCGGACTGCTGGGAACACCGGTGCTGTACGACGGCGAG
GGGCCCGACGCCCCCGGGTCCGTCCAGGTGACCGGAAGTCCCAAACTCCGTGCGCTGTTC
GTCGCGTTGCTGCTCGACGCCGGGCGGGTCGTGTCCGTCGAGGCGCTGAAGGACGCCCTG
TGGGGCGGTGCGCCGCCCGTCTCCGCGCTGCCCTCGCTGCACAATCACGTCGCCCGGTTG
CGGCGGCTGCTCGACGACCCGGGCCGGCTGCTCACCGTGCCCACCGGATATCTGCTGCGG
GTGGGAGAGGGCGAGGTGGACGTCCAGGTCTTCGACGCGCACACCGCAGCCGCCCGCGCC
GCGCACACCGCCCGGGACTGGGAGCGGGTGGCGCGCGAGTGCGCCGCCGCGCTCGCGCTG
TGGCGGGGGAACCCGCTGGCCGGGATGCCCCCGGAAGTGGGCGGCTACGCCCTGGTGCGG
CGGCTGCGCGAGGCGCGGCTGCTGCTCCTGGAGTGGCGGTACGACGCCGAACTGGCCCTG
GGCGGCGAGCGCCTGGCCGATCTCGTGCCCGAACTGGCGGCACTGGCCGCCGAACATCCG
CTGCGGGAGTCGTACCACCGTCAGCTGATGCTCGCGCTGCACCGCACCGGCCGTCAGGCG
GAGGCGCTGGTGGTCCACCGGGATCTGCGGGCCCGCCTGGCGGACGAACTCGGCGTCGAA
CCGGGGCCGGGGGTGCGCGAGGCCCACGTGGAGGTGCTGCGGGGGCAGGGGGAGCGGCAG
GAGCACGGTCGGTGCGCGGAGGCCGCAGGAGGGGGCGGTGTGCCGCCCAGGCCGGCGCAA
CTGCCGCCCGCGCCTGCTCACTTCACCGGGCGGGACGCGGTGCGGGACGAGCTGATCCGT
GTGCTCACCCGTGCCCCCCGGCCCGCCGCCGGGCCCCCTGCCGTCGTCGTCAGCGGTACC
GCTGGTGTGGGGAAGAGCGCGCTCGCCGTCCAGGTCGCACACACACTGGCGGAACGTTTC
GTCGACGGTCAGCTCTACGTCAACCTGCACGGCACGACCCCCGGCATGACCCCCCTCACC
CCCGCCCAGGCCCTCAGCGCTCTCCTGCGCGACCTGGGCACCGAGCCCTGCGCCGTCCCC
GAACGGCCGGACGCGGCCGCCGCCCTGCTGCGCTCGCTGCTCGCGCCCACCCGCACCCTC
CTGGTGCTGGACGACGCCGCGGACGCCGCGCAGGTGCGGCCGCTGCTGCCGGGCGGACCC
GGCTGTGCGGTGATCGTCACCAGCCGTTCGCCGCTCACCACGCTCGACGGTGCCGTCCGT
GTCCCGCTCGGCCCGCTGTCCGACGAGGACAGTGCCGCCCTGCTGCGGGCGGTCTCCGGC
CGGGACGGTCTCGGCGCCGGGCACCCGCTCGTCGCGCTCACCGGCCGGCTTCCGCTGGCC
CTGCGGGTGGTCGCGGCCCGGCTCGCCGCGCGCCGGGCCCTCACGCCCGACGACCTCGCC
GGTCAGCTCTCCGCCACCGACAGCCGGTTGCCGCACCTGGAGTACGACGACCTCAGCGTG
CGCCGCTCGCTGGCCGTCGCGCACGACGCGCTCACCGTCTCCGACCGTGAGACGGACCGC
GACGCCGCCCTCGCCCTGTGCCGCATCGGCGCGCTCGACCTGCCCGCCTACGGCGCGCCG
CTGCTCGCCCGGCTCACCGGCACCGGCGAACGCCGGGCGGAGGCCGCGCTGGACCGGCTC
GTCGACGTGGCCCTCGTGGAGGAGACCGCGTACGGCCGCTACGTCCCCCACGACCTGGTC
CGTGACTTCGCCCGCGAACGAGCCCGAGCGGCGGCGGGTCCGCAGACCGCGCCCCGCGAG
GACGCCGCACTCCGCGAGGACGCCGTACTCCGCGAGGATGCCGTACTCCGCGAGGATGCC
GTACTCCGCGAGGGCGCCGTACTCCGCGAGGGCGCCGTACTCCGCGAGGGCGCCGTACTC
CGCGAGGGCGCCGCACCCCGCGAGGGCGCCGCACCCCGCGAGGAGGCCGTACTCCGCGAG
GATGCCGCACCCCGCGAGGACGCCGCACCCCGCGAGGACGCCGGCCCTCGGACCGGCACG
CGCGAGCACCCCGCCGAGACCGCCCTGCGCTGGTACGCCGCCGTCGCCGAACGCGCCCTC
ACCGCGATCGTCGAACCCGGCCCCGACCAGGACGACCGCCGCCGCCCGACCCCGTCCCAG
CCGCCCGGGCACACCGCTCACGTCGCGTCCGTACCCCCGTTCGACGACGCGGGGGCGGCC
TTCGCCTGGGGCGACCGGGAGCTGGAGAACATCGTCACCCTCGTCGGGCGGTACGCCGGT
GAGGGCACCGGCGGGGGCGGTGACCGGGGCCGTCACGACGTCCACATCGCCGTACTCCTC
CGCCTGCTCCACCCCTACCTCCTGCGCGGCGGCCGGGTCCCCGAGCTGGAGGTGCTCGGG
CGGGCGGCCCTGCGGGTGGCGCGGCGGCTCGGGGACGAGGCCGCCGAGGCGTGCGCGCTG
GGCGATCTGGCGGGGCTGCACTTCCTGACCGGTCGCACCGGCGAGGCCCTCGCCCTCACC
GACCGCGCGCTGGAGATCTGGCGGCGGCTCGGAGCCGTCTCCTGGATCCGGCGCGCCCTC
AACCACCGGGGGCTGCTGCTCGAAGGGCTCGGCCGGTACGCGGAGTCGGAGCGGGCACTG
CGGCAGAGCCTCACCCACTCGCGGCAGTTGGCCGACCCCTACGGCGAGGCCGTCACCCTC
AGCCACCTCGGCAACCTGTACGAGCACACCGATCCGCGCGCGGCGATCGACCAGCACCGG
CGCTCGCTCGTGATCGGGGACCGCATCGGAGCGGTGATCGTGCGGCACTCCGCCCACTGC
AACATCGGCTACGCCCACCTCCGGCTGGGTGAACCGGCCGCCGCCCTGCCGCACTTCGAG
GAGAGCCTGCGCATCCTCGCCGGGCACGGCGACTGGCACGGAGAGTCCCAGACCCGGCTC
GGCCTGGTGCGCGCCCTGCGGCTGCTGGGGCACGCCGGCCGGGCCGACGCCGAGTGCGCC
GAACTGCTGCGCCGCGCGGACGCCCGAGCCGACCGCTACACCGGTGGTCTGGCCCGCCAC
CAGTACGGTCTGCTGCTGCGCGAGCGGGGGCGGGTGGGCGAGGCGCGCGAGCAGTGGCGG
TCGGCGCTCGCCGCGCTGGACGGCACGGACGAGCGGGCCGTGGTGGAGGAGTTGCGCGGA
CTCGTGGCCGGTGCCCGGCCGGCGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000767 Disease resistance protein (Family)
 [314-329]  1.6999992228405e-06 PR00364 [393-407]  1.6999992228405e-06 PR00364 [474-488]  1.6999992228405e-06 PR00364
PR00364   DISEASERSIST
IPR001440 Tetratricopeptide TPR-1 (Repeat)
 [958-985]  0.00018 PF00515
PF00515   TPR_1
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [27-99]  7.60000011115812e-14 SM00862
SM00862   Trans_reg_C
 [30-97]  2.6e-10 PF00486
PF00486   Trans_reg_C
IPR002182 NB-ARC (Domain)
 [313-492]  9.60000000000001e-10 PF00931
PF00931   NB-ARC
IPR003593 AAA+ ATPase domain (Domain)
 [311-468]  3.69999844802221e-05 SM00382
SM00382   AAA
IPR005158 Bacterial transcriptional activator domain (Domain)
 [106-253]  1.40000000000001e-44 PF03704
PF03704   BTAD
 [106-253]  6.89998448199219e-48 SM01043
SM01043   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [811-913]  2.4e-28 G3DSA:1.25.40.10 [914-1080]  1.99999999999999e-21 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [33-100]  4.5e-07 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR013105 Tetratricopeptide TPR2 (Repeat)
 [878-906]  0.049 PF07719
PF07719   TPR_2
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [5-100]  2.00000075217457e-13 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
IPR019734 Tetratricopeptide repeat (Repeat)
 [837-870]  0.129999995835436 SM00028 [877-910]  0.00329999983317491 SM00028 [956-989]  1.60000065022528e-05 SM00028
SM00028   TPR
SignalP No significant hit
TMHMM No significant hit
first first   Gilvo_00020 Gilvo_00020