close all open/close all

CDS information : Gilvo_00030


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction6,052 / 5,414 / - [in whole cluster]
6,052 / 5,414 / - [in contig]
Locationcomplement(5414..6052) [in whole cluster]
complement(5414..6052) [in contig]
TypeCDS
Length639 bp (212 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)gilL
EC number
Keyword
Note
Note (GenBank)
  • GilL
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
Related Reference
ACC
P30043
PmId
[7929092] Biliverdin-IX alpha reductase and biliverdin-IX beta reductase from human liver. Purification and characterization. (J Biol Chem. , 1994)
[10620517] Initial-rate kinetics of the flavin reductase reaction catalysed by human biliverdin-IXbeta reductase (BVR-B). (Biochem J. , 2000)

close this sectionSequence

selected fasta
>putative oxidoreductase [hypothetical protein]
MKVAVLGASGPTGRQVTALACAAGHDVVAVVRRPGSVTPGERLTVETADVTDVADMTSVF
KGADAVLSCLGAPYSWRPVTVYSASARAVVDGMRAADVRRLVVVSAGLTHPVTRGGVRWQ
RPVYGILRNGPGRTLYADMRRMEDILTGARDLEWTVMRPARLSDEARPGDELRVTADLPG
GRAWTTRRDLAIAMLDELTTPHTHQSPFVTTR
selected fasta
>putative oxidoreductase [hypothetical protein]
ATGAAAGTAGCAGTGCTCGGTGCAAGCGGCCCGACCGGACGGCAGGTGACGGCCCTGGCC
TGTGCGGCCGGCCATGACGTCGTCGCCGTCGTCCGGCGTCCGGGTTCGGTCACTCCGGGG
GAGAGGCTGACCGTGGAAACGGCGGACGTCACGGACGTCGCGGACATGACGTCCGTGTTC
AAGGGCGCCGACGCCGTCCTGTCCTGCCTGGGAGCGCCGTACTCCTGGAGGCCGGTCACG
GTCTACTCGGCGTCCGCCCGGGCCGTCGTGGACGGGATGCGCGCGGCGGACGTCAGGCGC
CTGGTCGTCGTGAGCGCCGGCCTGACACATCCGGTCACCCGGGGCGGGGTGCGATGGCAG
CGGCCGGTCTACGGCATCCTGCGCAACGGCCCCGGGCGGACCCTGTACGCGGACATGCGC
CGCATGGAGGACATCCTCACCGGAGCCCGCGACCTGGAGTGGACGGTCATGCGTCCCGCC
CGGCTCAGCGACGAGGCACGCCCGGGCGACGAGCTGCGGGTCACCGCCGACCTTCCCGGC
GGACGGGCATGGACGACGCGCCGCGACCTCGCGATCGCCATGCTCGACGAACTCACCACC
CCGCACACGCACCAGAGCCCCTTCGTCACCACCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [1-210]  2.4e-44 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-22]  0.34 Signal
Bacteria, Gram-positive   
 [1-29]  0.67 Signal
Eukaryota   
TMHMM No significant hit