close all open/close all

CDS information : Gilvo_00040


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction7,769 / 6,573 / - [in whole cluster]
7,769 / 6,573 / - [in contig]
Locationcomplement(6573..7769) [in whole cluster]
complement(6573..7769) [in contig]
TypeCDS
Length1,197 bp (398 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)putative cytochrome P-450 monooxygenase
Gene
Gene (GenBank)gilOIII
EC number
Keyword
  • C-1'' hydroxylate
  • vinyl group formation
Note
Note (GenBank)
  • GilOIII
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
[16795121] Inactivation of gilGT, encoding a C-glycosyltransferase, and gilOIII, encoding a P450 enzyme, allows the details of the late biosynthetic pathway to gilvocarcin V to be delineated. (Chembiochem. , 2006)

close this sectionSequence

selected fasta
>cytochrome P450 [putative cytochrome P-450 monooxygenase]
MISTSTIPHLDLDPYTDASITDPYPLYGALRDAAPVVYLTAHQVHCAARYDEVYAALHRH
GTFVSGEGVGLTDTLNKAQKGSSFTSDPPYHAYVRGLVARHLKPRAMADINGYVTSWADR
LVRDLVARKSFDAVQDFAVAFPLAVVPDLLGWPEGEGKERLLEWASAGFNAFGPLNDRTR
AGLPLLGEMGEFLHRMSQPGNLRPGSWGAELVSEAREGKIEDKLLPGLLGDFLAPSMDTS
VSALSSMLWLLGTHQDQWRRLREDPSLVSSAFNEIIRLESPLRGFTRYVAEDTELGGAAL
PRGSRVLLLFGSANRDERFWKDPESFDVARQGAAQHVGFGHGIHACVGQALSRLEGQSLL
EALVRHVDRIEVGEPTWRLHNTIRGIERMDVTFHGRTA
selected fasta
>cytochrome P450 [putative cytochrome P-450 monooxygenase]
GTGATCTCCACATCGACGATCCCCCACCTCGATCTCGATCCGTACACGGACGCGTCGATA
ACCGACCCGTACCCCCTGTACGGTGCGCTGCGCGACGCGGCACCGGTGGTGTACCTGACG
GCGCACCAGGTGCACTGCGCCGCCCGCTACGACGAGGTGTACGCGGCCCTGCACCGCCAC
GGCACGTTCGTGTCCGGCGAGGGCGTCGGTCTGACCGACACCCTGAACAAGGCGCAGAAG
GGCAGTAGCTTCACCAGCGACCCGCCGTACCACGCCTACGTGCGGGGGCTCGTGGCCCGC
CACCTGAAGCCCCGCGCGATGGCCGACATCAACGGGTACGTCACGTCCTGGGCGGACCGT
CTTGTCCGGGACCTCGTCGCCCGGAAGTCGTTCGACGCCGTCCAGGACTTCGCGGTCGCC
TTCCCGCTGGCCGTGGTGCCCGATCTGCTGGGATGGCCGGAGGGCGAGGGGAAGGAAAGG
CTCCTGGAGTGGGCCAGCGCCGGATTCAACGCCTTCGGTCCCCTGAACGACCGGACGCGG
GCCGGCCTGCCGCTGCTCGGCGAGATGGGCGAGTTCCTCCACCGGATGTCACAGCCCGGC
AATCTGCGTCCGGGGAGCTGGGGTGCCGAACTCGTCTCGGAGGCCCGCGAGGGCAAGATC
GAGGACAAGCTGCTGCCCGGACTGCTCGGTGACTTCCTCGCCCCGTCCATGGACACGTCC
GTCAGCGCGCTCTCCAGCATGCTGTGGCTGCTCGGCACGCACCAGGACCAGTGGCGCCGT
CTGCGGGAGGACCCCTCCCTGGTCTCGTCGGCCTTCAACGAGATCATCCGGCTGGAATCG
CCGCTGCGCGGGTTCACCCGCTACGTCGCCGAGGACACGGAGCTGGGCGGAGCCGCGCTG
CCCCGCGGATCGCGCGTCCTCCTCCTCTTCGGTTCGGCCAACCGTGACGAGCGGTTCTGG
AAGGACCCGGAGTCCTTCGACGTCGCCCGGCAGGGCGCGGCCCAGCACGTCGGTTTCGGG
CACGGTATCCACGCCTGCGTCGGTCAGGCCCTGTCCCGCCTGGAGGGGCAGAGCCTCCTG
GAGGCGCTGGTCCGTCACGTCGACAGGATCGAGGTGGGGGAGCCGACCTGGAGGCTGCAC
AACACCATCCGCGGGATCGAGAGGATGGATGTGACGTTCCATGGACGAACTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [3-396]  8.79996401030984e-74 SSF48264
SSF48264   Cytochrome_P450
 [12-396]  1.10000000000001e-82 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [217-366]  3.7e-19 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [86-97]  3.60000433965927e-31 PR00359 [132-148]  3.60000433965927e-31 PR00359 [270-281]  3.60000433965927e-31 PR00359 [287-314]  3.60000433965927e-31 PR00359 [315-330]  3.60000433965927e-31 PR00359 [337-346]  3.60000433965927e-31 PR00359 [346-357]  3.60000433965927e-31 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [339-348]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit