close all open/close all

CDS information : Gilvo_00050


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction8,913 / 7,774 / - [in whole cluster]
8,913 / 7,774 / - [in contig]
Locationcomplement(7774..8913) [in whole cluster]
complement(7774..8913) [in contig]
TypeCDS
Length1,140 bp (379 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductC-glycosyltransferase
Product (GenBank)putative C-glycosyltransferase
Gene
Gene (GenBank)gilGT
EC number
Keyword
  • D-fucofuranose
Note
Note (GenBank)
  • GilGT
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
[16795121] Inactivation of gilGT, encoding a C-glycosyltransferase, and gilOIII, encoding a P450 enzyme, allows the details of the late biosynthetic pathway to gilvocarcin V to be delineated. (Chembiochem. , 2006)
[21075894] Engineered biosynthesis of gilvocarcin analogues with altered deoxyhexopyranose moieties. (Appl Environ Microbiol. , 2011)
Related Reference
ACC
Q9ZGC0
NITE
Lando_00200
PmId
[15977274] LanGT2 Catalyzes the First Glycosylation Step during landomycin A biosynthesis. (Chembiochem. , 2005)
[21513888] Rational design of an aryl-C-glycoside catalyst from a natural product O-glycosyltransferase. (Chem Biol. , 2011)

close this sectionSequence

selected fasta
>C-glycosyltransferase [putative C-glycosyltransferase]
MKALFYAAGTSPASAFAIGPLASALRLSGHDVLVASFEEMSGAVTGIGLPSLPVARGHTT
ESIKAAAGGKPAIEYPHRPEQEMPYLGHWFGRQGSHVFDDLVDVARTWGADVLIAGSQGH
GAEIAARFLGIPFVRQSWDLFDVGGYEEYLLEEMADELARIGSDALPDPSLKIDICPPGL
VGATGTFMRWTPHNMQRAIEPWMLTAPDAGRVCLTMGSFRYAFPGAMDRISAIVEGLLEL
EVEVVVAIGEAEGQRLQEKYPRVRAGWIPLEAILPTCEVIIHPAGGLTAINAINTATPQL
ILNPFEAFVPRLKHLTDYGCARTLYREEGTPEAITQVVKEMLGDPSYSSRARRLAEQGAT
APTAVGMVPLIEDLLARKG
selected fasta
>C-glycosyltransferase [putative C-glycosyltransferase]
GTGAAGGCCCTCTTCTACGCCGCGGGCACGAGCCCGGCCAGCGCGTTCGCCATCGGACCC
CTCGCCTCGGCACTCCGGTTGTCCGGGCACGACGTCCTGGTGGCGTCCTTCGAGGAGATG
TCCGGCGCCGTCACCGGCATCGGTCTGCCGTCCCTCCCGGTGGCCCGGGGGCACACGACC
GAGAGCATCAAGGCGGCCGCCGGCGGCAAGCCGGCGATCGAGTACCCCCACCGGCCCGAA
CAGGAGATGCCCTACCTGGGCCACTGGTTCGGGCGTCAGGGAAGCCACGTCTTCGACGAC
CTGGTGGACGTCGCCCGGACGTGGGGCGCCGACGTCCTGATCGCGGGGAGCCAGGGACAC
GGTGCCGAGATCGCCGCCCGGTTCCTCGGCATCCCCTTCGTCCGGCAGTCCTGGGACCTG
TTCGACGTCGGCGGCTACGAGGAGTACCTCCTCGAGGAGATGGCGGACGAGCTGGCCAGG
ATCGGCTCGGACGCACTGCCCGACCCCTCACTGAAGATCGACATCTGCCCGCCCGGCCTG
GTCGGGGCGACCGGCACCTTCATGCGCTGGACCCCGCACAACATGCAGCGGGCGATCGAG
CCGTGGATGCTGACGGCTCCGGACGCCGGGCGCGTGTGCCTGACGATGGGAAGCTTCCGG
TACGCCTTCCCCGGCGCGATGGACCGCATCTCGGCCATCGTCGAAGGGCTGCTGGAGCTC
GAGGTCGAGGTCGTCGTGGCCATCGGCGAGGCGGAGGGGCAGCGGCTGCAGGAGAAGTAC
CCCCGGGTGCGCGCCGGCTGGATCCCGCTGGAGGCCATCCTCCCGACCTGTGAGGTGATC
ATCCATCCGGCGGGCGGACTGACGGCCATCAACGCCATCAACACGGCGACTCCGCAGCTG
ATCCTCAACCCCTTCGAGGCCTTCGTCCCGAGGCTGAAGCACCTCACGGACTACGGGTGC
GCGCGGACGCTCTACCGCGAGGAGGGCACCCCGGAGGCGATCACGCAGGTGGTCAAGGAG
ATGCTCGGGGATCCGTCCTACTCCTCCAGGGCCCGGAGACTGGCGGAGCAGGGCGCGACC
GCGCCGACGGCCGTGGGCATGGTGCCGCTGATCGAAGACCTCCTCGCGCGGAAAGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010610 Domain of unknown function DUF1205 (Domain)
 [173-262]  3.1e-15 PF06722
PF06722   DUF1205
SignalP
 [1-17]  0.939 Signal
Bacteria, Gram-negative   
 [1-24]  0.532 Signal
Bacteria, Gram-positive   
 [1-15]  0.953 Signal
Eukaryota   
TMHMM No significant hit