close all open/close all

CDS information : Gilvo_00060


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction9,260 / 8,910 / - [in whole cluster]
9,260 / 8,910 / - [in contig]
Locationcomplement(8910..9260) [in whole cluster]
complement(8910..9260) [in contig]
TypeCDS
Length351 bp (116 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)gilV
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
[16795121] Inactivation of gilGT, encoding a C-glycosyltransferase, and gilOIII, encoding a P450 enzyme, allows the details of the late biosynthetic pathway to gilvocarcin V to be delineated. (Chembiochem. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MKFAAVLVVNYLTPWYELSLDERITVEHEHVFPSIGAFVKRGGEITPVRAIKYGREAESF
FILGFDEMDNYLDLVRELRSSRLLTSGLAVIDFETVGLKEAYFAERDKDRSREGAA
selected fasta
>hypothetical protein [hypothetical protein]
ATGAAGTTCGCCGCCGTCCTTGTCGTCAACTACCTCACCCCGTGGTACGAGTTGTCCCTC
GACGAGCGCATCACGGTCGAACACGAGCACGTCTTCCCCAGCATCGGCGCCTTCGTGAAG
CGGGGCGGGGAGATAACACCGGTGCGCGCCATCAAGTACGGCCGTGAGGCGGAGAGTTTC
TTCATCCTGGGCTTCGACGAGATGGACAACTACCTGGACCTGGTCCGGGAGCTGCGTTCG
AGTCGTCTGCTGACCTCGGGCCTCGCCGTCATCGACTTCGAGACCGTGGGCCTGAAGGAG
GCCTACTTCGCGGAACGCGACAAGGACCGGTCACGGGAGGGCGCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit