close all open/close all

CDS information : Gilvo_00070


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction10,000 / 9,257 / - [in whole cluster]
10,000 / 9,257 / - [in contig]
Locationcomplement(9257..10000) [in whole cluster]
complement(9257..10000) [in contig]
TypeCDS
Length744 bp (247 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productoxidoreductase/C-12 O-methyltransferase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)gilM
EC number
Keyword
  • quinone reduction
  • hemiacetal formation
Note
Note (GenBank)
  • GilM
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
[22800463] Roles of the Synergistic Reductive O-Methyltransferase GilM and of O-Methyltransferase GilMT in the Gilvocarcin Biosynthetic Pathway. (J Am Chem Soc. , 2012)

close this sectionSequence

selected fasta
>oxidoreductase/C-12 O-methyltransferase [hypothetical protein]
MPTGSTEKIPFEKLYQDGEKSGPLMPWNIGGPQPAVRAICDRGGFRGHVLDLGCGLGDNA
LYLASRGLRVSAVDISEVAVQCGRDKARDHGVSVDFQVTDAFRLAESGVRYDAVLDSAFF
HTLPQEEVPRYTELLRTLCKEGAELHLFTFSKELTPDYPGPRRISEPELREAFGADWDIK
VIEATRYHSSLPPEAVAQMVDPRTFEVNAPTDNLAAQMVDEAGNVVSHIWHMHAVLRPQA
TRSESPA
selected fasta
>oxidoreductase/C-12 O-methyltransferase [hypothetical protein]
ATGCCAACGGGCAGCACGGAGAAGATCCCCTTCGAGAAGCTCTACCAGGACGGGGAGAAG
TCAGGCCCCCTCATGCCGTGGAACATCGGCGGCCCGCAGCCGGCCGTACGCGCGATCTGT
GATCGCGGCGGCTTCCGCGGGCACGTGCTCGATCTGGGCTGCGGGCTCGGAGACAACGCG
CTCTACCTGGCTTCCCGGGGGCTGCGGGTCTCCGCGGTCGACATCTCGGAGGTCGCCGTC
CAGTGCGGGCGCGACAAGGCCCGGGACCACGGCGTGAGCGTCGACTTCCAGGTGACCGAC
GCCTTCCGCCTCGCGGAGTCCGGTGTCCGGTACGACGCCGTCCTGGACAGCGCCTTCTTC
CACACGCTGCCGCAGGAGGAGGTGCCGCGCTACACGGAGCTCCTGCGGACCCTGTGCAAG
GAGGGGGCCGAGCTGCACCTGTTCACCTTCTCGAAGGAGCTGACCCCCGACTACCCGGGT
CCGCGCCGCATCTCCGAACCGGAGTTGCGGGAGGCGTTCGGCGCCGACTGGGACATCAAG
GTGATCGAGGCGACGCGGTACCACAGCTCGCTGCCGCCGGAGGCCGTCGCGCAGATGGTC
GACCCGCGGACCTTCGAGGTGAACGCCCCCACCGACAACCTCGCCGCCCAGATGGTGGAC
GAAGCCGGGAACGTCGTCTCCCACATCTGGCACATGCATGCCGTACTGCGTCCGCAGGCA
ACCCGATCGGAGAGCCCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008854 TPMT family (Family)
 [25-185]  1e-15 PF05724
PF05724   TPMT
SignalP No significant hit
TMHMM No significant hit