close all open/close all

CDS information : Gilvo_00090


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction12,195 / 11,509 / - [in whole cluster]
12,195 / 11,509 / - [in contig]
Locationcomplement(11509..12195) [in whole cluster]
complement(11509..12195) [in contig]
TypeCDS
Length687 bp (228 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productdehydrorabelomycin C-5 hydroxylase/Baeyer-Villiger monooxygenase/decarboxylase
Product (GenBank)putative anthrone monooxygenase
Gene
Gene (GenBank)gilOII
EC number
Keyword
  • ring opening
Note
  • multifunctional protein
Note (GenBank)
  • GilOII
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
[17346045] Multi-oxygenase complexes of the gilvocarcin and jadomycin biosyntheses. (J Am Chem Soc. , 2007)
[22465094] Delineation of gilvocarcin, jadomycin, and landomycin pathways through combinatorial biosynthetic enzymology. (Curr Opin Chem Biol. , 2012)
[23102024] Baeyer-Villiger C-C bond cleavage reaction in gilvocarcin and jadomycin biosynthesis. (J Am Chem Soc. , 2012)
Related Reference
ACC
Q5U914
NITE
Jado_00140
PmId
[15776503] The oxidative ring cleavage in jadomycin biosynthesis: a multistep oxygenation cascade in a biosynthetic black box. (Chembiochem. , 2005)
[22465094] Delineation of gilvocarcin, jadomycin, and landomycin pathways through combinatorial biosynthetic enzymology. (Curr Opin Chem Biol. , 2012)
[23177193] Identification of JadG as the B ring opening oxygenase catalyzing the oxidative C-C bond cleavage reaction in jadomycin biosynthesis. (Chem Biol. , 2012)
[23102024] Baeyer-Villiger C-C bond cleavage reaction in gilvocarcin and jadomycin biosynthesis. (J Am Chem Soc. , 2012)

close this sectionSequence

selected fasta
>dehydrorabelomycin C-5 hydroxylase/Baeyer-Villiger monooxygenase/decarboxylase [putative anthrone monooxygenase]
MPIIEPENGSLTVFNLFNTTDSEKQATLLDAMRGIIANANYPGWRSSTLHAGVARPCAAN
YIQWRSINDLRERYEGENFKHNTVPYFTELTTSVHLLKTEVVSVQTKDGAARTEIGPDRG
DLTVIVLMGCDPKDQGELVSLLEKPDDWMRQVPGYRSHSILRALDGDMVINYAQWDDAAS
YEAFHAMPEEERPAHDREMRARGKALLTSRESNTYETVFTQSVEGYAS
selected fasta
>dehydrorabelomycin C-5 hydroxylase/Baeyer-Villiger monooxygenase/decarboxylase [putative anthrone monooxygenase]
ATGCCGATCATCGAGCCCGAGAACGGCTCCCTGACCGTGTTCAACCTGTTCAACACCACC
GACTCGGAGAAGCAGGCGACCCTCCTGGACGCCATGCGCGGCATCATCGCGAACGCGAAC
TACCCGGGATGGCGGTCGTCGACCCTGCACGCGGGGGTGGCGAGGCCCTGTGCGGCCAAC
TACATACAGTGGCGGTCGATCAACGACCTGAGGGAGCGGTACGAGGGGGAGAACTTCAAG
CACAACACGGTCCCCTACTTCACCGAACTCACCACGTCGGTGCACCTGCTGAAGACCGAG
GTGGTGTCCGTCCAGACGAAGGACGGTGCCGCCCGCACGGAGATCGGCCCGGACCGGGGG
GACCTGACCGTCATCGTCCTGATGGGGTGCGACCCCAAGGACCAGGGCGAGCTCGTGTCC
CTGCTGGAGAAGCCGGACGACTGGATGCGGCAGGTGCCCGGGTACCGGTCCCACAGCATC
CTCAGGGCGCTCGACGGCGACATGGTCATCAACTACGCCCAGTGGGACGACGCGGCCTCC
TACGAGGCGTTCCACGCCATGCCCGAGGAGGAACGCCCGGCGCACGACCGGGAGATGCGC
GCACGCGGCAAGGCGCTGCTGACCTCGCGGGAGTCCAACACCTACGAGACCGTGTTCACC
CAGTCGGTCGAGGGGTACGCGTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [123-189]  3.60000000000001e-09 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-105]  2.59999946718995e-16 SSF54909 [112-221]  6.69999687625999e-21 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit