close all open/close all

CDS information : Gilvo_00100


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction13,423 / 12,350 / - [in whole cluster]
13,423 / 12,350 / - [in contig]
Locationcomplement(12350..13423) [in whole cluster]
complement(12350..13423) [in contig]
TypeCDS
Length1,074 bp (357 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductSAM-dependent O-methyltransferase
Product (GenBank)putative O-methyltransferase
Gene
Gene (GenBank)gilMT
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • GilMT
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
[22800463] Roles of the Synergistic Reductive O-Methyltransferase GilM and of O-Methyltransferase GilMT in the Gilvocarcin Biosynthetic Pathway. (J Am Chem Soc. , 2012)
Related Reference
ACC
P16559
PmId
[1548230] Nucleotide sequence of the tcmII-tcmIV region of the tetracenomycin C biosynthetic gene cluster of Streptomyces glaucescens and evidence that the tcmN gene encodes a multifunctional cyclase-dehydratase-O-methyl transferase. (J Bacteriol. , 1992)

close this sectionSequence

selected fasta
>SAM-dependent O-methyltransferase [putative O-methyltransferase]
MTITASGSLPPSAPVAVQILDLLMGGWRAGVVSTFAELGVADGLAAGGLTPAQLAVRLGL
EHDTAERFFRAGASVGLLRRGEHDTLELTELGRALASDDGSMRNFARWTGSTAERATWAH
LATAVRTGRSPFAAMHGSGVWEFMESDPDTAAVFNSAMTELSKRVIQPVIEAFDFSRFSS
VTDVGGGRGALLAAVLRKHPEMTGVLFDQPDVVSRSLPELSDAAVAHRVTVKSGSFFDGV
PSGSDLFMISNVLHDWDDGRSRLILRNIAEAMHEGAHIAVVEAVAGLDDTADKAISLMDM
DMLLLCEGKQRTVEEFRLLMAEVGIELVGVSRAGLQSVVEGRKVSGETGTPGSPRSR
selected fasta
>SAM-dependent O-methyltransferase [putative O-methyltransferase]
ATGACCATTACTGCATCGGGATCGCTGCCCCCGTCGGCACCCGTCGCTGTGCAGATCCTC
GACCTCCTGATGGGAGGCTGGCGCGCCGGTGTCGTCAGCACGTTCGCGGAACTGGGCGTG
GCCGACGGCCTGGCCGCCGGCGGGCTGACGCCCGCACAACTGGCGGTCCGGCTGGGGTTG
GAGCACGACACCGCGGAGCGCTTCTTCCGCGCCGGCGCCTCCGTGGGGCTGCTGCGGAGG
GGCGAGCACGACACGCTGGAGCTGACGGAGCTGGGCCGGGCCCTGGCCTCCGACGACGGC
TCCATGCGCAACTTCGCGCGGTGGACGGGGTCGACGGCCGAACGCGCGACCTGGGCCCAC
CTGGCCACCGCGGTGCGCACCGGCCGCTCTCCCTTCGCCGCGATGCACGGTTCGGGCGTG
TGGGAGTTCATGGAGTCGGATCCCGACACCGCGGCCGTCTTCAACTCGGCCATGACCGAA
CTGTCCAAGCGCGTCATCCAGCCCGTGATCGAGGCGTTCGACTTCTCCCGGTTCAGCAGT
GTCACCGACGTGGGCGGGGGGAGGGGGGCGCTGCTGGCCGCCGTGCTCCGCAAGCACCCC
GAGATGACCGGCGTCCTCTTCGACCAGCCGGACGTCGTGTCGCGGTCCCTGCCGGAGCTG
TCGGACGCGGCGGTGGCCCACCGCGTCACGGTGAAGTCCGGCTCCTTCTTCGACGGCGTT
CCGTCGGGCAGCGACCTGTTCATGATCTCCAACGTGCTGCACGACTGGGACGACGGCCGT
TCCCGTCTCATCCTCAGGAACATCGCGGAGGCCATGCACGAGGGGGCGCACATCGCCGTC
GTGGAGGCTGTGGCGGGCCTGGACGACACGGCGGACAAGGCGATCTCCCTCATGGACATG
GACATGCTCCTCCTGTGCGAAGGCAAACAGCGCACCGTGGAGGAGTTCCGGCTCCTGATG
GCCGAGGTCGGGATCGAGCTGGTCGGGGTCAGCCGCGCCGGACTCCAGTCCGTCGTCGAA
GGAAGGAAGGTCTCGGGGGAGACCGGTACACCGGGCTCTCCCCGCAGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [85-320]  2.59999999999998e-58 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [16-91]  4.5e-14 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [3-343]  3.00000067992871e-14 PIRSF005739
PIRSF005739   O-mtase
SignalP
 [1-29]  0.175 Signal
Bacteria, Gram-negative   
TMHMM No significant hit