close all open/close all

CDS information : Gilvo_00110


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction15,465 / 13,810 / - [in whole cluster]
15,465 / 13,810 / - [in contig]
Locationcomplement(13810..15465) [in whole cluster]
complement(13810..15465) [in contig]
TypeCDS
Length1,656 bp (551 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)putative transmembrane efflux protein
Gene
Gene (GenBank)gilJ
EC number
Keyword
Note
Note (GenBank)
  • GilJ
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
Related Reference
ACC
O52557
NITE
Rifam_00370
PmId
[17351715] RifP; a membrane protein involved in rifamycin export in Amycolatopsis mediterranei. (Biotechnol Lett. , 2007)

close this sectionSequence

selected fasta
>putative drug resistance transporter [putative transmembrane efflux protein]
MNAVSDNPTRSSPANRDPWLGLLAISLGVSLVVVDFTIVNVVMPPIIDDLEISAFGAQWI
QESYAIILAALLLVMGRLSDVVGARRLFLIGTVVFGLASIAAALAPSGELLIASRFAQGV
GGAIIMPTSLALLNMSFRGADRGKAFAIWGSTIGAAAAVGPLLGGWLAEFSWRWAFGINI
FVVVLIIAGVMKFLDQSPAQPGKVDAVGGVLSVLGLGLLAFALIEGRNYGWWDPRKSFGP
FGDPVELSVIPVALVVSVVCLGLFLQRQVRLTRVDGTAPLMDTSLFGIKSFSTGNIATLI
IALAEFGMLAVLPLWLQYTLGYSVLQTGLIVFVVAVGSFFASGASFGMAENVGPIGLVRI
GLVLEAVGLLMFGLLASSDSQWWVIGIALFLYGMGVGFATAQVTNVVLADVPPRHAGQGS
GIQSAARQLGSALGIAILTSTFFTALDSDLSDRLVDQGTPAPEANELSSAVSDSAGAMIS
GLSENPDTAAAADAARDAMSYAIQINGYTCAALLALGMLATFLIPRPKGDAQQWGGENAP
RGAEEADVDAK
selected fasta
>putative drug resistance transporter [putative transmembrane efflux protein]
ATGAACGCAGTGTCTGACAATCCAACTCGGTCCTCACCGGCCAACCGGGACCCCTGGCTG
GGCTTGCTCGCCATTTCTCTCGGTGTGTCGCTGGTGGTCGTGGACTTCACCATCGTCAAC
GTGGTGATGCCGCCGATCATCGACGACCTCGAGATCTCGGCCTTCGGCGCCCAGTGGATC
CAGGAGTCCTACGCGATCATCCTGGCCGCTCTGCTGCTGGTGATGGGGCGTCTGTCGGAC
GTGGTGGGAGCACGCCGGCTGTTCCTCATCGGCACCGTGGTGTTCGGGCTGGCGAGCATC
GCCGCCGCCCTGGCGCCCTCCGGGGAACTCCTGATCGCCAGCCGGTTCGCCCAGGGCGTC
GGCGGCGCGATCATCATGCCGACCTCGCTCGCCCTGCTCAACATGTCCTTCCGGGGAGCC
GACCGGGGCAAGGCCTTCGCCATCTGGGGGTCCACGATCGGTGCGGCCGCCGCGGTCGGC
CCGCTCCTGGGCGGCTGGCTCGCCGAGTTCTCCTGGCGGTGGGCGTTCGGCATCAACATC
TTCGTCGTGGTGCTGATCATCGCGGGCGTCATGAAGTTCCTGGACCAGTCCCCCGCGCAG
CCGGGCAAGGTCGACGCCGTCGGCGGCGTGCTGTCGGTGCTGGGCCTCGGACTTCTCGCC
TTCGCGCTGATCGAGGGCCGCAACTACGGCTGGTGGGACCCGCGCAAGAGCTTCGGTCCC
TTCGGCGACCCGGTGGAGCTGTCGGTCATCCCGGTCGCCCTGGTCGTCTCCGTGGTGTGC
CTGGGGCTGTTCCTGCAGCGCCAGGTCCGGCTCACCCGGGTGGACGGCACGGCGCCGCTG
ATGGACACCTCGCTGTTCGGCATCAAGTCCTTCAGCACGGGCAACATCGCGACGCTGATC
ATCGCGCTGGCGGAGTTCGGCATGCTCGCCGTTCTCCCCCTGTGGCTCCAGTACACGCTG
GGGTACTCGGTGCTCCAGACCGGACTGATCGTCTTCGTCGTCGCGGTCGGCAGCTTCTTC
GCGAGCGGTGCGAGCTTCGGCATGGCCGAGAACGTCGGCCCCATCGGGCTGGTGCGCATC
GGCCTCGTCCTCGAGGCCGTCGGTCTGCTGATGTTCGGTCTGCTGGCCAGCAGCGACTCG
CAGTGGTGGGTCATCGGCATCGCCCTCTTCCTGTACGGCATGGGAGTCGGGTTCGCTACG
GCGCAGGTCACCAACGTCGTCCTGGCGGACGTGCCGCCGCGGCACGCCGGCCAGGGATCC
GGCATCCAGAGCGCCGCACGCCAGCTCGGTTCCGCGCTCGGCATCGCGATTCTGACGTCG
ACCTTCTTCACGGCACTGGACTCCGACCTGTCCGACCGGCTCGTCGACCAGGGGACGCCC
GCGCCGGAGGCGAACGAGCTGTCGTCGGCGGTCTCCGACAGCGCCGGCGCGATGATCTCC
GGACTGAGTGAGAACCCGGACACGGCGGCCGCCGCCGACGCCGCCCGCGACGCCATGTCG
TACGCGATCCAGATCAACGGCTACACCTGCGCCGCGCTGCTGGCGCTCGGGATGCTGGCG
ACCTTCCTCATCCCGCGGCCCAAGGGGGACGCCCAGCAGTGGGGAGGGGAGAACGCTCCC
CGCGGGGCCGAGGAAGCCGACGTGGACGCGAAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [23-447]  5.6e-75 TIGR00711
TIGR00711   Efflux_EmrB
IPR011701 Major facilitator superfamily (Family)
 [26-434]  1.9e-50 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-529]  8.70005082121737e-72 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [21-529]  PS50850
PS50850   MFS
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [20-42]  Transmembrane (i-o) [52-74]  Transmembrane (o-i) [87-106]  Transmembrane (i-o) [111-133]  Transmembrane (o-i) [146-168]  Transmembrane (i-o) [172-194]  Transmembrane (o-i) [207-224]  Transmembrane (i-o) [244-265]  Transmembrane (o-i) [294-316]  Transmembrane (i-o) [326-348]  Transmembrane (o-i) [355-377]  Transmembrane (i-o) [387-409]  Transmembrane (o-i) [429-446]  Transmembrane (i-o) [502-524]  Transmembrane (o-i)
Transmembrane 14