close all open/close all

CDS information : Gilvo_00120


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction15,618 / 16,643 / + [in whole cluster]
15,618 / 16,643 / + [in contig]
Location15618..16643 [in whole cluster]
15618..16643 [in contig]
TypeCDS
Length1,026 bp (341 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative DeoR family transcriptional regulator
Product (GenBank)putative repressor
Gene
Gene (GenBank)gilI
EC number
Keyword
Note
Note (GenBank)
  • GilI
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
Related Reference
ACC
Q54822
NITE
Adria_00110
PmId
[10846224] The dnrO gene encodes a DNA-binding protein that regulates daunorubicin production in Streptomyces peucetius by controlling expression of the dnrN pseudo response regulator gene. (Microbiology. , 2000)
[20122958] The activator/repressor protein DnrO of Streptomyces peucetius binds to DNA without changing its topology. (Int J Biol Macromol. , 2010)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>putative DeoR family transcriptional regulator [putative repressor]
MIANRTLELLSLLQTQREWTGDGLAERLGVSPRTVRRDINRLRELGYPVTATKGPSGSYR
LSRGARLPPLIVDDEQALAIALSLQTAPASVTGMGDATKRALNSIQELLPPHLAHRLATF
SVEQIENAWELAPPQVDPSLLAQLSSAAQQRDLVRFSYRSIHHDSMQDGEVLAEPHRLVV
WSGRWYLVAYDQQRSSWHAYRVDRIKDLAPTAWRFGEREGPDEDITRFVQNQPDRGDTPD
TWPCWGTVLMECPASLVAKWAPGVASFEAVDDRVTRIQMGAWSWSALIGFLITFSCRFTV
EGPPELVAAARRVMGLIDVGIPSHDPLAEPSSRTPGPSAGR
selected fasta
>putative DeoR family transcriptional regulator [putative repressor]
TTGATCGCCAACCGCACGTTGGAACTCCTCAGCCTGTTACAGACCCAGAGGGAGTGGACC
GGTGACGGGCTGGCCGAGCGGCTGGGTGTGTCCCCGCGGACCGTCCGGCGCGACATCAAC
CGACTCCGCGAGCTGGGCTACCCCGTCACGGCGACGAAAGGCCCCTCCGGCTCCTACCGG
CTGTCCCGCGGAGCGCGTCTTCCTCCCCTGATAGTCGACGACGAGCAGGCCCTCGCCATC
GCCCTGTCCCTGCAGACCGCGCCGGCCTCGGTGACCGGCATGGGAGACGCCACCAAACGT
GCGCTGAACTCCATCCAGGAACTGTTGCCACCTCATCTGGCCCACCGGCTCGCCACCTTC
TCCGTCGAACAGATCGAGAACGCGTGGGAACTCGCTCCGCCGCAGGTCGACCCCTCCCTG
CTCGCACAGCTCAGCAGCGCCGCCCAGCAGCGTGACCTCGTGAGGTTCTCCTACCGCTCC
ATCCACCACGACTCGATGCAGGACGGGGAGGTCCTGGCCGAACCCCACCGGCTCGTCGTC
TGGTCGGGACGCTGGTACCTGGTGGCCTACGACCAGCAGCGGAGCTCATGGCACGCCTAC
CGGGTCGACCGCATCAAGGATCTGGCGCCCACCGCCTGGCGCTTCGGCGAGCGGGAGGGT
CCCGACGAGGACATCACCCGCTTCGTACAGAACCAGCCCGATCGCGGTGACACCCCGGAC
ACCTGGCCCTGCTGGGGCACCGTCCTGATGGAGTGTCCCGCGTCGCTGGTGGCGAAGTGG
GCCCCGGGAGTGGCGAGTTTCGAGGCGGTCGACGACAGGGTCACCCGGATCCAGATGGGC
GCGTGGTCGTGGTCGGCGCTCATCGGCTTCCTGATCACCTTCAGTTGCCGCTTCACCGTC
GAGGGTCCGCCCGAACTCGTCGCCGCGGCGCGGAGGGTGATGGGCCTCATCGACGTCGGG
ATTCCGTCGCACGACCCCCTCGCGGAGCCGTCGAGCCGCACACCCGGCCCCTCGGCCGGC
CGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001034 HTH DeoR N-terminal domain (Domain)
 [2-57]  PS51000
PS51000   HTH_DEOR_2
 [5-58]  8.29999581180008e-06 SM00420
SM00420   HTH_DEOR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [3-62]  9e-18 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR013196 Helix-turn-helix, type 11 (Domain)
 [5-57]  1.4e-15 PF08279
PF08279   HTH_11
IPR018356 Transcription regulator, HTH DeoR-type, conserved site (Conserved_site)
 [5-39]  PS00894
PS00894   HTH_DEOR_1
SignalP No significant hit
TMHMM No significant hit