close all open/close all

CDS information : Gilvo_00130


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction17,696 / 16,686 / - [in whole cluster]
17,696 / 16,686 / - [in contig]
Locationcomplement(16686..17696) [in whole cluster]
complement(16686..17696) [in contig]
TypeCDS
Length1,011 bp (336 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)putative NDP-glucose 4,6 dehydratase
Gene
Gene (GenBank)gilE
EC number4.2.1.46
Keyword
  • D-fucofuranose
Note
Note (GenBank)
  • GilE
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
Related Reference
ACC
Q194R3
NITE
Mith_00070
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [putative NDP-glucose 4,6 dehydratase]
MTATRILVTGGAGFIGSHYVRTLLGPHGPAGVRITVLDKLTYAGNPANLDPVRAHPGFRL
VQGDVCDAAVVDRLVAEHDQIVHFAAESHVDRSILGGAEFVRTNVGGTQVLLDAALRHHG
RGRGVFVQVSTDEVYGSIPYGSWPETHPLSPSSPYAASKAAADLVALAHHRTHGLDVRVT
RCSNNYGHHHFPEKLIPLFITRLLEGRTVPLYGDGLNVRDWLHIDDHVQGIELVRTKGRP
GEVYNIGGGTELTNRELVSLLLEACGAGWESVEYVADRKGHDRRYSVDCAKITLELGYEP
RKDFATGLAETVSWYRENRDWWEPLRQRAELGQAVR
selected fasta
>putative dTDP-glucose 4,6-dehydratase [putative NDP-glucose 4,6 dehydratase]
ATGACCGCCACGAGGATCCTCGTCACCGGTGGTGCCGGCTTCATCGGCTCCCACTACGTC
CGCACCCTGCTCGGCCCGCACGGGCCCGCCGGGGTCCGCATCACCGTGCTCGACAAACTG
ACCTATGCCGGCAACCCGGCCAACCTCGACCCGGTCCGTGCCCACCCCGGGTTCCGCCTC
GTCCAGGGCGATGTCTGCGACGCCGCGGTCGTGGACCGGCTGGTCGCCGAGCACGACCAG
ATCGTGCACTTCGCCGCGGAGTCGCACGTGGACCGGTCGATCCTGGGGGGCGCCGAGTTC
GTCCGCACGAACGTGGGCGGAACGCAGGTCCTGCTCGACGCGGCGCTGCGCCACCACGGA
CGCGGCCGCGGCGTCTTCGTCCAGGTCTCCACGGACGAGGTGTACGGCTCGATCCCCTAC
GGTTCGTGGCCGGAGACGCACCCGCTGTCACCCAGTTCGCCCTACGCGGCCTCGAAGGCC
GCCGCCGACCTCGTCGCCCTCGCCCACCACCGCACCCACGGCCTCGACGTCCGGGTGACC
CGCTGCTCCAACAACTACGGCCATCACCACTTCCCCGAGAAGCTGATCCCGCTGTTCATC
ACGCGCCTCCTCGAGGGCCGCACCGTCCCGCTGTACGGGGACGGGCTCAACGTCCGCGAC
TGGCTGCACATCGACGACCACGTCCAGGGCATCGAACTGGTCCGCACGAAGGGCAGACCC
GGCGAGGTCTACAACATCGGCGGCGGCACCGAGCTCACCAACAGGGAACTGGTGTCACTG
CTCCTGGAGGCGTGCGGGGCCGGCTGGGAGTCGGTGGAGTACGTCGCCGACCGCAAGGGA
CACGACAGGCGCTACTCGGTGGACTGCGCCAAGATCACCCTGGAGCTGGGCTACGAGCCC
CGCAAGGATTTCGCCACCGGCCTCGCGGAGACCGTCTCCTGGTACCGGGAGAACCGGGAC
TGGTGGGAACCGCTGCGGCAGCGCGCCGAGCTGGGACAGGCGGTCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [6-247]  1.99999999999999e-63 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [5-325]  3.30000000000002e-126 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [3-194]  2.99999999999998e-60 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [142-170]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit