close all open/close all

CDS information : Gilvo_00140


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction18,760 / 17,693 / - [in whole cluster]
18,760 / 17,693 / - [in contig]
Locationcomplement(17693..18760) [in whole cluster]
complement(17693..18760) [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)putative NDP-glucose synthase
Gene
Gene (GenBank)gilD
EC number2.7.7.24
Keyword
  • D-fucofuranose
Note
Note (GenBank)
  • GilD
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
Related Reference
ACC
Q194R4
NITE
Mith_00060
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [putative NDP-glucose synthase]
MKALVLSGGAGTRLRPITHSYAKQLVPVANKPVLFYGLEAIAEAGITEVGIVVGDTAAEI
QQAVGDGSAFGLDVTYIRQAAPLGLAHAVLIAREFLGDDDFVMYLGDNFIVGGIADLVAG
FRESRPDTHILLTKVADPSAFGVVELDDDGKAVALEEKPAAPRSDLALVGVFLFTSVVHE
AVRGIEPSARGELEITDALQWLIDHGYDVRSTTISGYWKDTGNVIDMLEVNRAVLEGAKG
RVDGYVDADSEVIGQVTIEAGAEIRGSRIVGPAVIGANTRITGSYVGPSTSIAADCRIES
SEIEFSIVLAGATVQGVRRVESSLIGRNVEVTPAAGVPAAHRLVLGDHSEVRISS
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [putative NDP-glucose synthase]
ATGAAGGCTCTCGTACTGTCCGGCGGGGCCGGAACCCGCCTGAGGCCCATCACCCATTCC
TACGCCAAGCAGCTCGTCCCCGTAGCCAACAAGCCCGTGCTCTTCTACGGGTTGGAGGCG
ATCGCGGAGGCAGGCATCACCGAGGTCGGCATCGTCGTCGGGGACACGGCCGCCGAGATC
CAGCAGGCGGTCGGCGACGGCTCCGCCTTCGGTCTGGACGTCACCTACATACGGCAGGCG
GCGCCGCTCGGTCTCGCCCATGCCGTCCTGATCGCCCGGGAGTTCCTCGGCGACGACGAC
TTCGTCATGTACCTCGGAGACAACTTCATCGTGGGCGGTATCGCGGATCTCGTGGCCGGG
TTCCGCGAGAGCCGGCCCGACACGCACATCCTCCTGACCAAGGTGGCCGACCCCAGCGCC
TTCGGTGTCGTCGAACTCGACGACGACGGGAAGGCGGTGGCGCTGGAGGAGAAGCCGGCC
GCTCCGCGCAGCGACCTGGCCCTGGTCGGCGTCTTCCTGTTCACCTCCGTGGTGCACGAG
GCCGTCCGGGGGATCGAGCCGTCCGCACGCGGCGAGCTGGAGATCACCGACGCCCTGCAG
TGGCTCATCGACCACGGGTACGACGTCCGCTCCACCACCATTTCCGGTTACTGGAAGGAC
ACCGGGAACGTCATCGACATGCTGGAGGTCAACCGGGCCGTGCTGGAGGGCGCCAAGGGC
CGGGTCGACGGCTATGTCGACGCGGACAGCGAGGTCATCGGCCAGGTCACGATCGAGGCG
GGCGCCGAGATCCGCGGATCGCGGATCGTGGGGCCGGCCGTGATCGGCGCCAACACGCGG
ATCACCGGCTCCTACGTCGGCCCGTCCACGTCGATAGCGGCGGACTGCCGGATCGAGTCC
AGCGAGATCGAGTTCTCCATCGTCCTCGCCGGGGCCACGGTCCAGGGGGTCCGCCGCGTG
GAGAGTTCCCTGATCGGGCGGAACGTCGAGGTGACCCCCGCCGCCGGTGTGCCGGCGGCC
CACCGGCTGGTCCTCGGGGACCACAGCGAGGTGCGTATCTCGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-236]  5.00000000000001e-57 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-352]  TIGR01208
TIGR01208   RmlA_long
SignalP
 [1-22]  0.303 Signal
Bacteria, Gram-positive   
TMHMM No significant hit