close all open/close all

CDS information : Gilvo_00150


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction18,937 / 19,578 / + [in whole cluster]
18,937 / 19,578 / + [in contig]
Location18937..19578 [in whole cluster]
18937..19578 [in contig]
TypeCDS
Length642 bp (213 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)putative reductase
Gene
Gene (GenBank)gilH
EC number
Keyword
Note
Note (GenBank)
  • GilH
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
[19067453] Inactivation of the ketoreductase gilU gene of the gilvocarcin biosynthetic gene cluster yields new analogues with partly improved biological activity. (Chembiochem. , 2009)
Related Reference
ACC
Q6T1C6
PmId
[15123249] Generation of new landomycins by combinatorial biosynthetic manipulation of the LndGT4 gene of the landomycin E cluster in S. globisporus. (Chem Biol. , 2004)
ACC
Q07923
PmId
[15184374] Crystal structure and functional characterization of yeast YLR011wp, an enzyme with NAD(P)H-FMN and ferric iron reductase activities. (J Biol Chem. , 2004)
ACC
Q9ZGB0
NITE
Lando_00300
PmId
[15812784] Generation of novel landomycins M and O through targeted gene disruption. (Chembiochem. , 2005)
[22454092] Elucidation of post-PKS tailoring steps involved in landomycin biosynthesis. (Org Biomol Chem. , 2012)

close this sectionSequence

selected fasta
>putative oxidoreductase [putative reductase]
MIRIAVILGSTRPGRRGAVVAQWVAEVAARHPAAVMGEAEFELVDLAEYGLPLLDEPVPA
MFGQYQKEETRRWAAAIGSFDGFVFVTPEYNHSVPAALKNAIDHLFAEWTDKAAGFVSYG
VHGGTRAVEHLRLALAEVKVAGVRSQVVLSVFNDFDYTGCDMTDPTAMGRFTPGPQQEQT
VNTMLDEVVAWSTALKPLRTAATAEADGRAVSV
selected fasta
>putative oxidoreductase [putative reductase]
ATGATCAGGATCGCCGTCATCCTCGGAAGCACGCGTCCCGGCCGCCGCGGGGCCGTGGTG
GCCCAATGGGTCGCCGAGGTCGCCGCGCGGCATCCCGCGGCGGTGATGGGCGAGGCGGAG
TTCGAGCTGGTCGACCTGGCGGAGTACGGCCTCCCGTTGCTCGACGAGCCCGTGCCGGCG
ATGTTCGGCCAGTACCAGAAGGAGGAGACCCGGCGGTGGGCCGCCGCCATCGGCTCGTTC
GACGGATTCGTCTTCGTCACGCCGGAGTACAACCACTCGGTGCCCGCCGCGCTGAAGAAC
GCCATCGACCACCTCTTCGCCGAGTGGACCGACAAGGCGGCCGGGTTCGTCAGCTACGGC
GTGCACGGGGGAACCCGTGCCGTCGAGCACCTGCGGCTGGCCCTGGCCGAGGTGAAGGTG
GCCGGGGTGCGCAGCCAGGTCGTCCTGTCGGTGTTCAACGACTTCGACTACACGGGATGC
GACATGACGGACCCGACGGCCATGGGCCGGTTCACGCCGGGACCGCAGCAGGAGCAGACG
GTGAACACGATGCTGGACGAGGTCGTCGCCTGGTCGACGGCGCTCAAGCCGCTGCGTACT
GCTGCGACCGCTGAGGCGGACGGCCGGGCCGTGTCGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005025 NADPH-dependent FMN reductase (Domain)
 [3-150]  2.29999999999998e-41 PF03358
PF03358   FMN_red
SignalP
 [1-29]  0.526 Signal
Eukaryota   
TMHMM No significant hit