close all open/close all

CDS information : Gilvo_00170


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction21,412 / 21,738 / + [in whole cluster]
21,412 / 21,738 / + [in contig]
Location21412..21738 [in whole cluster]
21412..21738 [in contig]
TypeCDS
Length327 bp (108 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)putative cyclase
Gene
Gene (GenBank)gilG
EC number
Keyword
  • angucycline
Note
Note (GenBank)
  • GilG
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
Related Reference
ACC
Q93LY5
PmId
[12654660] Engineering anthracycline biosynthesis toward angucyclines. (Antimicrob Agents Chemother. , 2003)
ACC
Q9XCV6
NITE
Jado_00070
PmId
[11520231] Production of aromatic minimal polyketides by the daunorubicin polyketide synthase genes reveals the incompatibility of the heterologous DpsY and JadI cyclases. (J Nat Prod. , 2001)

close this sectionSequence

selected fasta
>putative cyclase [putative cyclase]
MFSSLIVARMDTGHAEAVADVFAGFDATDMPARMGTRRRELFRYRGLYFHLQDFETPDGT
EAVEAAKSDPRFIRVSNDLRPYIEAYAPDWQSPKDAMAERFYHWSSKR
selected fasta
>putative cyclase [putative cyclase]
TTGTTCAGCTCTCTCATCGTCGCCCGGATGGACACCGGCCACGCCGAAGCGGTGGCCGAC
GTCTTCGCCGGCTTCGACGCCACCGACATGCCCGCGCGGATGGGCACGCGGCGCCGCGAA
CTCTTCCGCTACCGCGGCCTCTACTTCCACCTCCAGGACTTCGAGACCCCCGACGGGACC
GAAGCGGTCGAGGCGGCCAAGTCCGACCCGCGGTTCATCCGGGTGAGCAACGACCTCAGG
CCCTACATCGAGGCCTACGCCCCGGACTGGCAATCACCGAAGGACGCCATGGCAGAGCGC
TTCTATCACTGGAGTTCGAAACGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006765 Polyketide synthesis cyclase (Family)
 [1-107]  2.70000000000002e-47 G3DSA:3.30.70.1090
G3DSA:3.30.70.1090   Cyclase_polyket
 [2-106]  PD012644
PD012644   Polyketide_synth_cyclase
 [10-105]  3.89999999999997e-40 PF04673
PF04673   Cyclase_polyket
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-107]  1.40000506907309e-43 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit