close all open/close all

CDS information : Gilvo_00180


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction21,735 / 22,994 / + [in whole cluster]
21,735 / 22,994 / + [in contig]
Location21735..22994 [in whole cluster]
21735..22994 [in contig]
TypeCDS
Length1,260 bp (419 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)putative alpha-ketoacyl synthase
Gene
Gene (GenBank)gilA
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • GilA
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
[20486694] Enzymatic total synthesis of rabelomycin, an angucycline group antibiotic. (Org Lett. , 2010)

close this sectionPKS/NRPS Module

KS3..372

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [putative alpha-ketoacyl synthase]
MSRRVFITGVGVVAPGAVGRDPFWELLTQGRTATRRLSLCDPEPFRSQVAAEADFDAEAA
GLSERQSAELDRAAQFALVAAREAVEDAAWSETCPPERAGVIVGSAVGATTKLEEVYRQL
SRDGSLWDVAPDSPAELYSYFVPSSFASGIAHDLGVTGQSGVVSTGCTSGIDSVGNAWEL
IQSGILDSAVCGATDAPISPITVACFDTIKATSTYNDTPESASRPFDATRGGFVLGEGSA
MFVLESEESVHRRGARVYGEIRGYASRCNAYHMTGLKADGRELAEAVVSALGQAGVDPGR
LDYVNAHGSGTKQNDRHETAALKSSLGPAAHDVPISSIKSMIGHSLGAIGSLEIAACALA
LRDDVIPPTANLTRPDPELDLDYVPVHARKQPTNSVLTTGSGFGGFQSAMVLTDPEHHS
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [putative alpha-ketoacyl synthase]
ATGAGCCGCAGGGTCTTCATCACCGGGGTCGGTGTCGTCGCGCCGGGAGCCGTCGGACGT
GACCCCTTCTGGGAGCTGCTGACCCAAGGGCGCACGGCCACCCGCCGGCTCAGCCTCTGC
GACCCGGAGCCCTTCCGGTCCCAGGTGGCCGCGGAGGCCGACTTCGACGCCGAGGCGGCG
GGGCTGTCGGAGCGGCAGTCCGCGGAACTGGACCGGGCGGCGCAGTTCGCCCTGGTCGCC
GCCCGTGAAGCGGTCGAGGACGCGGCATGGTCCGAGACATGTCCTCCCGAACGCGCCGGA
GTGATCGTGGGTTCGGCCGTCGGAGCCACGACCAAGCTCGAGGAGGTCTACCGGCAGCTC
AGCCGTGACGGCTCCCTCTGGGACGTGGCCCCCGACTCCCCCGCCGAGCTGTACTCGTAC
TTCGTGCCCAGCTCGTTCGCCTCCGGCATCGCACACGACCTCGGCGTCACGGGGCAGAGC
GGCGTCGTGTCGACCGGGTGCACCTCCGGGATCGACTCCGTCGGCAACGCCTGGGAACTG
ATCCAGAGCGGCATCCTGGACTCCGCCGTCTGCGGTGCCACCGACGCCCCCATCTCGCCC
ATCACCGTCGCCTGCTTCGACACGATCAAGGCGACATCGACGTACAACGACACCCCGGAG
AGCGCCTCACGGCCGTTCGACGCCACACGGGGCGGCTTCGTCCTCGGCGAGGGCAGCGCG
ATGTTCGTCCTCGAATCGGAGGAATCCGTCCACCGTCGCGGCGCACGCGTCTACGGCGAG
ATCCGCGGCTACGCGAGCCGCTGCAACGCCTACCACATGACCGGTCTCAAGGCCGACGGA
CGCGAGCTGGCGGAGGCCGTCGTCTCCGCTCTCGGCCAGGCAGGCGTGGACCCGGGCCGG
CTCGACTACGTCAACGCCCACGGCAGCGGCACGAAGCAGAACGACCGCCACGAGACCGCC
GCGCTGAAGTCGTCCCTCGGACCCGCCGCCCACGACGTGCCGATCAGTTCGATCAAGTCG
ATGATCGGCCATTCGCTGGGCGCCATCGGGTCGTTGGAGATCGCCGCCTGCGCCCTGGCG
CTGCGGGACGACGTGATCCCGCCGACGGCCAATCTCACCCGGCCGGATCCGGAACTCGAT
CTGGACTACGTGCCGGTCCACGCGCGCAAGCAGCCGACCAACAGCGTGCTCACGACCGGA
AGCGGCTTCGGTGGGTTTCAGAGCGCCATGGTTCTCACGGACCCGGAGCATCACTCATGA
KS3..372
KS7..1116

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-248]  2.99999999999998e-51 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [258-372]  2.70000000000002e-37 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [7-263]  1.29999999999998e-59 G3DSA:3.40.47.10 [268-415]  4.39999999999997e-49 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-255]  4.69998262513195e-59 SSF53901 [217-416]  7.30000590915205e-62 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [158-174]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-19]  0.582 Signal
Bacteria, Gram-negative   
 [1-19]  0.97 Signal
Eukaryota   
TMHMM No significant hit