close all open/close all

CDS information : Gilvo_00190


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction22,991 / 24,166 / + [in whole cluster]
22,991 / 24,166 / + [in contig]
Location22991..24166 [in whole cluster]
22991..24166 [in contig]
TypeCDS
Length1,176 bp (391 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)putative beta-ketoacyl synthase
Gene
Gene (GenBank)gilB
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • GilB
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
[20486694] Enzymatic total synthesis of rabelomycin, an angucycline group antibiotic. (Org Lett. , 2010)

close this sectionPKS/NRPS Module

CLF4..351

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [putative beta-ketoacyl synthase]
MTAHITGIDIVSPLGLSREEHWKALLDGCSGLRATQSFDSSRYDNPISGEVPHFAPEGLP
KRLLPATDRMTQMSLVAAAGAFDDSGVDTSRVDPLGVGVMTASTAGGYAFGQKELQNLWS
KGPRYVSTHQSYAWFYAVNTGQISIRHGCQGHSGVIVADDAGGLDAISFAARRLARGNRV
MLTGSVDSTMCPWGRVAHTSTGMLSASTDARAAYLPFDARANGWVNGEGGAHLVLQTHSD
GRYAAVLGHGATMDDPRAAPGTGLVRAIHLALGAARLRPGDISVVFADAAGTREADTAEA
AALAEVFGPDSVPVTAPKAATGRMGCGTAALDVATAVLALRDQTIPPTVNVQADASLGVN
LCSVATHHPLTNVLVLARGVGGFNSALIVGK
selected fasta
>polyketide synthase chain length factor subunit [putative beta-ketoacyl synthase]
ATGACCGCACACATCACCGGCATCGACATCGTCTCCCCGCTGGGCCTGTCCCGCGAGGAA
CACTGGAAGGCCCTCCTCGACGGATGCAGCGGTCTGAGGGCGACGCAGTCGTTCGACTCC
AGCAGGTACGACAACCCCATCAGCGGGGAGGTGCCCCACTTCGCCCCGGAGGGCCTGCCC
AAGCGGCTGCTGCCGGCCACCGACCGGATGACCCAGATGTCGCTGGTCGCCGCGGCGGGG
GCGTTCGACGACAGCGGTGTCGACACGAGCCGGGTCGACCCCCTCGGAGTCGGTGTCATG
ACGGCGTCCACCGCGGGGGGTTACGCGTTCGGGCAGAAGGAGCTGCAGAACCTGTGGTCC
AAGGGGCCCAGGTACGTCAGCACCCATCAGTCCTACGCCTGGTTCTACGCGGTCAACACC
GGTCAGATCTCCATCCGGCACGGCTGCCAGGGCCACAGCGGAGTGATCGTCGCGGACGAC
GCCGGCGGGCTCGACGCGATCTCCTTCGCCGCCCGCCGTCTGGCGCGCGGCAACCGCGTC
ATGCTCACCGGGTCGGTGGACAGCACGATGTGTCCCTGGGGGCGGGTCGCGCACACCTCG
ACCGGCATGCTCTCGGCATCCACCGACGCGCGGGCCGCGTACCTTCCGTTCGACGCACGA
GCCAACGGGTGGGTCAACGGCGAAGGCGGCGCGCACCTCGTGCTGCAGACCCACAGTGAC
GGCCGCTACGCGGCGGTGCTCGGTCACGGTGCGACCATGGACGATCCCCGCGCCGCCCCG
GGCACGGGCCTCGTCCGGGCGATCCACCTCGCGCTCGGCGCGGCGCGGCTGCGCCCCGGC
GACATCAGTGTGGTGTTCGCCGACGCGGCCGGCACCCGGGAGGCGGACACCGCCGAGGCC
GCCGCCCTCGCCGAGGTCTTCGGGCCGGATTCCGTCCCCGTCACCGCGCCCAAGGCGGCG
ACCGGCCGGATGGGCTGCGGGACGGCCGCACTCGACGTCGCGACGGCGGTGCTCGCCCTC
CGCGACCAGACGATTCCCCCCACCGTCAACGTCCAGGCCGACGCGTCCCTGGGGGTCAAC
CTGTGCAGCGTCGCCACACACCACCCCCTCACCAACGTCCTGGTCCTGGCCCGGGGCGTC
GGTGGGTTCAACTCGGCCCTGATCGTCGGGAAATGA
CLF4..351
CLF10..1053

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [4-240]  8.00000000000001e-42 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [243-351]  7.1e-24 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [5-240]  4.10000000000004e-40 G3DSA:3.40.47.10 [259-390]  9.8e-30 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-246]  2.19999900980707e-47 SSF53901 [209-391]  2.60000517657733e-33 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit