close all open/close all

CDS information : Gilvo_00210


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction24,448 / 25,227 / + [in whole cluster]
24,448 / 25,227 / + [in contig]
Location24448..25227 [in whole cluster]
24448..25227 [in contig]
TypeCDS
Length780 bp (259 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative polyketide C-9 ketoreductase
Product (GenBank)putative ketoreductase
Gene
Gene (GenBank)gilF
EC number
Keyword
Note
Note (GenBank)
  • GilF
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
Related Reference
ACC
Q8VWB5
PmId
[8157619] Nucleotide sequence of the aknA region of the aklavinone biosynthetic gene cluster of Streptomyces galilaeus. (J Bacteriol. , 1994)
ACC
Q56166
NITE
Jado_00110
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative polyketide C-9 ketoreductase [putative ketoreductase]
MTSPRHALVTGGSSGIGKSVARRLASAGHTVTICGRDSERLQQAAKELSEQGAPVTSLIA
DVSKPRQVGDLVREAVETNGPLGILVNNAGRNGGGRTAELSDELWREVLSTNLDSVFYVT
REVLARGGIGEVDHARIINIASTAGKQGVLLAAPYSASKHGVVGFTKAVGKELAPQGITV
NAVCPGYVETPMASRVRQAYADAWETTEAEVLSAFEAKIPLGRYSTPDEVASLVEYLTTE
GAASITAQAFNVCGGLGNF
selected fasta
>putative polyketide C-9 ketoreductase [putative ketoreductase]
GTGACCTCTCCCCGTCATGCCCTGGTCACCGGCGGTTCCAGCGGCATAGGAAAGTCCGTC
GCACGGCGCCTGGCCTCGGCCGGCCACACCGTCACGATCTGCGGTCGTGACTCCGAAAGG
CTCCAGCAGGCCGCCAAGGAACTGTCGGAGCAGGGTGCACCCGTCACCTCGCTGATCGCC
GACGTCAGCAAGCCCCGCCAGGTGGGCGATCTGGTCCGCGAGGCCGTGGAGACGAACGGT
CCCCTCGGGATCCTCGTCAACAACGCGGGCAGGAACGGAGGCGGCCGGACCGCGGAGCTG
AGCGACGAGCTGTGGCGGGAGGTACTGAGCACCAACCTCGACAGCGTTTTCTACGTCACG
CGGGAGGTGCTGGCCCGTGGCGGCATCGGCGAGGTGGACCACGCCCGGATCATCAACATC
GCCTCCACCGCGGGGAAGCAGGGAGTTCTGCTGGCCGCCCCGTACTCCGCCTCCAAGCAC
GGTGTCGTCGGCTTCACCAAGGCGGTGGGCAAGGAGCTGGCCCCTCAGGGGATCACCGTG
AACGCCGTCTGCCCGGGCTACGTGGAGACCCCGATGGCCTCACGGGTCCGGCAGGCCTAC
GCAGACGCCTGGGAGACCACGGAGGCCGAGGTGCTGTCCGCCTTCGAGGCGAAGATCCCG
CTCGGCCGGTACAGCACGCCCGACGAGGTCGCCTCGCTGGTCGAGTACCTCACGACCGAA
GGAGCCGCCTCGATCACGGCTCAGGCGTTCAACGTGTGCGGCGGCCTCGGCAACTTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [80-91]  9.40001006865064e-12 PR00080 [135-143]  9.40001006865064e-12 PR00080 [155-174]  9.40001006865064e-12 PR00080
PR00080   SDRFAMILY
 [6-173]  4.2e-36 PF00106
PF00106   adh_short
 [1-243]  9.30000048475975e-16 PIRSF000126
PIRSF000126   11-beta-HSD1
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [6-23]  2.50000909916183e-42 PR00081 [80-91]  2.50000909916183e-42 PR00081 [129-145]  2.50000909916183e-42 PR00081 [155-174]  2.50000909916183e-42 PR00081 [176-193]  2.50000909916183e-42 PR00081 [220-240]  2.50000909916183e-42 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [4-256]  2.90000000000003e-78 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [142-170]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-27]  0.425 Signal
Bacteria, Gram-positive   
TMHMM No significant hit