close all open/close all

CDS information : Gilvo_00220


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction25,240 / 26,190 / + [in whole cluster]
25,240 / 26,190 / + [in contig]
Location25240..26190 [in whole cluster]
25240..26190 [in contig]
TypeCDS
Length951 bp (316 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)putative cyclase/dehydratase
Gene
Gene (GenBank)gilK
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
  • GilK
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
Related Reference
ACC
Q54221
NITE
Griseu_00050
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[10467128] Heterologous expression, purification, reconstitution and kinetic analysis of an extended type II polyketide synthase. (Chem Biol. , 1999)
ACC
Q54811
NITE
Adria_00240
PmId
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [putative cyclase/dehydratase]
MADPARTDLHSATITGSADAVYRRLEDVGQWSQMFEPTIHGAELARDGNRQTIQLWATAN
GEPKAWVSERELDPVARTIRFAQTVTSSPVAEMSGAWQVLPLSEDTCRVELTHTYRAEND
SAESLTWIARAVETNSTKELSALKFACERDADSEASPFTFTDAVDTTVDPVLLFSFLDRG
ELWAGRLEHVAEAEMREFSDGLQFLRMRTRTPDGDTHVTESYRVSQSPARLLYKQVTLPA
LLSLHTGEWTITPAGESWRVTSKHTVAIDPDAVHKVLGADATVSDAKRLARRNLGNNSLR
TLEAAVRWAGTAVSQR
selected fasta
>putative cyclase/dehydratase [putative cyclase/dehydratase]
ATGGCCGATCCGGCTCGCACAGACCTGCACTCCGCCACGATCACCGGCAGCGCCGACGCG
GTGTACCGCCGTCTGGAGGACGTCGGGCAGTGGTCCCAGATGTTCGAACCGACCATCCAC
GGCGCGGAACTGGCCCGGGACGGGAACAGGCAGACGATCCAGCTGTGGGCCACCGCCAAC
GGAGAACCCAAGGCCTGGGTCTCCGAGCGTGAGCTCGACCCCGTCGCGCGCACCATCCGC
TTCGCGCAGACCGTCACCTCCTCGCCCGTCGCCGAGATGTCCGGCGCGTGGCAGGTGCTG
CCCCTGTCCGAGGACACCTGCCGGGTCGAACTCACGCACACCTACCGTGCGGAGAACGAC
TCGGCGGAGTCGCTCACATGGATCGCCCGAGCCGTGGAGACCAACAGCACGAAGGAGCTC
TCGGCGCTCAAGTTCGCCTGCGAACGGGACGCCGACAGCGAGGCCAGTCCCTTCACCTTC
ACCGATGCGGTGGACACCACGGTCGACCCCGTCCTGCTGTTCTCGTTCCTGGACCGCGGT
GAGCTGTGGGCGGGACGCCTGGAGCACGTCGCCGAGGCCGAGATGAGGGAGTTCTCCGAC
GGCCTGCAGTTCCTCCGGATGCGGACGCGCACCCCGGACGGTGACACGCACGTCACCGAG
TCCTACCGGGTGTCGCAGAGCCCGGCCCGGCTGCTGTACAAGCAGGTGACGCTGCCCGCG
CTGCTGTCGCTGCACACCGGCGAGTGGACCATCACCCCGGCCGGGGAGAGCTGGCGGGTC
ACGTCGAAGCACACCGTGGCGATCGATCCCGACGCGGTGCACAAGGTCCTCGGTGCCGAC
GCGACGGTCTCGGACGCCAAGCGGCTCGCCCGGCGCAACCTGGGCAACAACAGCCTGCGG
ACCCTCGAAGCAGCGGTCCGGTGGGCCGGCACCGCCGTGTCGCAGAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [10-144]  2e-10 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [10-142]  2.5e-09 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit