close all open/close all

CDS information : Gilvo_00240


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction27,551 / 28,483 / + [in whole cluster]
27,551 / 28,483 / + [in contig]
Location27551..28483 [in whole cluster]
27551..28483 [in contig]
TypeCDS
Length933 bp (310 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyltransferase subunit
malonyl-CoA--acyl carrier protein transacylase
Product (GenBank)putative malonyl-CoA acyl carrier protein transacylase
Gene
Gene (GenBank)gilP
EC number
Keyword
  • type II PKS
  • malonyl-CoA
  • acetyl-CoA
Note
Note (GenBank)
  • GilP
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
[20617244] Delineating the earliest steps of gilvocarcin biosynthesis: role of GilP and GilQ in starter unit specificity. (Org Biomol Chem. , 2010)
[20486694] Enzymatic total synthesis of rabelomycin, an angucycline group antibiotic. (Org Lett. , 2010)

close this sectionPKS/NRPS Module

AT4..254

close this sectionSequence

selected fasta
>polyketide synthase acyltransferase subunit [putative malonyl-CoA acyl carrier protein transacylase]
MRAFLFPGQGTQKIGMGTYLRERYPHLIAPLWREADDVLGFPLTRLCEEGPGEKLRHMPV
TQPAVFLCSYAALVAAQANGAEPDVIAGHSLGEYSALAAAGVLTWQEVLQLVHRRGQLMA
EVQHKVDGKMAAVIGLAIGQVEEICEQVRSETGEVVEVANHNEPLQVVVSGQCAAIDLLV
QRVATATDVRTSVLRIGGPAHSSLMGSVAGDFVEYLRRFDFCTPKTMLISGSTAEPYASA
EEIRHQLGRQLVHRVRWVDVMAQLERLGVAQTWELGPGKVLSGFVQRSLPQVRTYRANDL
PSFLAGVTGW
selected fasta
>polyketide synthase acyltransferase subunit [putative malonyl-CoA acyl carrier protein transacylase]
GTGAGAGCGTTCCTGTTCCCCGGTCAGGGGACCCAGAAGATCGGCATGGGCACCTACCTG
CGAGAACGGTACCCCCACCTGATCGCGCCGTTGTGGCGGGAGGCGGACGACGTCCTGGGT
TTCCCCCTCACCCGCCTCTGCGAGGAAGGCCCCGGCGAGAAGCTCCGCCACATGCCGGTC
ACCCAGCCCGCCGTCTTCCTGTGCAGTTACGCCGCGCTCGTCGCCGCGCAGGCGAACGGC
GCGGAGCCGGACGTCATCGCGGGCCACAGTCTGGGCGAGTACTCGGCGCTGGCGGCGGCC
GGCGTCCTCACCTGGCAGGAGGTCCTTCAGCTCGTCCACCGCCGCGGTCAGCTCATGGCG
GAGGTGCAGCACAAGGTGGACGGGAAGATGGCGGCCGTCATCGGTCTCGCCATCGGGCAG
GTCGAGGAGATCTGCGAGCAGGTGCGGTCCGAGACCGGTGAGGTGGTCGAGGTGGCCAAC
CACAACGAGCCCCTCCAGGTCGTCGTCTCCGGCCAGTGCGCTGCCATAGACCTCCTGGTC
CAGCGCGTCGCGACGGCGACCGACGTCCGCACGTCCGTCCTGAGGATCGGTGGCCCGGCC
CACTCCAGTCTCATGGGCAGCGTCGCGGGGGACTTCGTGGAGTACCTCCGGCGCTTCGAC
TTCTGCACGCCCAAGACGATGCTGATCTCCGGGTCGACCGCCGAGCCCTACGCGAGTGCG
GAGGAGATCAGGCACCAGCTCGGCAGGCAGCTGGTGCACCGGGTGCGGTGGGTGGACGTG
ATGGCGCAGCTCGAGAGGCTGGGGGTCGCACAGACCTGGGAGCTGGGGCCGGGCAAGGTC
CTCTCGGGATTCGTACAGCGGTCGCTGCCTCAGGTGCGGACGTACCGCGCGAATGATCTG
CCGTCCTTCCTGGCCGGCGTGACGGGCTGGTGA
AT4..254
AT10..762

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [3-122]  3.99999999999998e-56 G3DSA:3.40.366.10 [198-295]  3.99999999999998e-56 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR004410 Malonyl CoA-acyl carrier protein transacylase, FabD-type (Family)
 [2-288]  1.29999999999998e-79 TIGR00128
TIGR00128   FabD
IPR014043 Acyl transferase (Domain)
 [4-254]  7.89999999999997e-37 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [1-303]  7.40000780398342e-60 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [126-197]  1.09999909120787e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR024925 Malonyl CoA-acyl carrier protein transacylase (Family)
 [1-307]  2.1000026783403e-63 PIRSF000446
PIRSF000446   Mct
SignalP No significant hit
TMHMM No significant hit