close all open/close all

CDS information : Gilvo_00250


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction28,500 / 29,519 / + [in whole cluster]
28,500 / 29,519 / + [in contig]
Location28500..29519 [in whole cluster]
28500..29519 [in contig]
TypeCDS
Length1,020 bp (339 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyltransferase subunit
Product (GenBank)putative acyl transferase
Gene
Gene (GenBank)gilQ
EC number
Keyword
  • type II PKS
  • propionyl-CoA
Note
Note (GenBank)
  • GilQ
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
[20617244] Delineating the earliest steps of gilvocarcin biosynthesis: role of GilP and GilQ in starter unit specificity. (Org Biomol Chem. , 2010)

close this sectionPKS/NRPS Module

AT23..331

close this sectionSequence

selected fasta
>polyketide synthase acyltransferase subunit [putative acyl transferase]
MPHQATGAAPDGGGSAPRSLVLMLPGQGSQFAAMGVPLYESDARFRKALDDFFDAFGTGA
ERLRREWLHGSAQGIERGSFAQPMLFGLDYAAGAVWLEELKGVDVTLVGHSVGELAAATL
AGAFDLELAGALLAERARLLDAAPRGGMIACRATEESLREHLDALGGRAVIAAENADNQC
VVSCAEEDLPDTMRYLGSHGVTCLRVASTEPFHSPLLAPAAARFEEFLARRGHRLSTTEL
PMVSAYSARRISGREIMPASFWTRQMAEKVRFWEALRHNFDSGPRTFVEIGPGTVLSLAA
RRLPSVRARRSTVISTMPRHRPHPEHWESAIHEVAEEFC
selected fasta
>polyketide synthase acyltransferase subunit [putative acyl transferase]
GTGCCGCATCAGGCAACCGGCGCCGCTCCCGACGGAGGGGGGTCCGCGCCCCGGTCCCTC
GTGCTGATGCTCCCCGGCCAGGGGTCGCAGTTCGCTGCCATGGGAGTCCCGCTCTACGAG
TCCGACGCCCGGTTCAGGAAGGCGCTCGACGACTTCTTCGACGCGTTCGGCACCGGTGCC
GAGCGGCTCCGGCGCGAGTGGCTGCACGGTTCGGCCCAGGGCATCGAACGTGGGTCCTTC
GCGCAGCCGATGCTGTTCGGCCTCGACTACGCGGCGGGCGCGGTGTGGCTGGAGGAGCTC
AAGGGTGTCGACGTGACGCTGGTCGGTCACAGCGTGGGCGAGCTGGCGGCGGCCACCCTC
GCGGGGGCCTTCGACCTCGAGCTGGCGGGGGCACTCCTGGCCGAGCGGGCCCGGCTCCTC
GACGCCGCCCCCCGGGGAGGGATGATCGCGTGCCGCGCGACGGAGGAGTCGCTGCGGGAG
CATCTCGACGCCCTGGGCGGACGCGCCGTCATCGCGGCGGAGAACGCGGACAACCAGTGC
GTCGTGAGCTGTGCCGAGGAAGACCTCCCGGACACGATGCGGTACCTCGGCTCGCACGGT
GTGACGTGCCTGCGCGTCGCCTCGACCGAACCGTTCCACTCCCCCCTCCTCGCCCCCGCC
GCCGCCCGGTTCGAGGAGTTCCTGGCCCGGCGCGGTCATCGTCTGTCCACGACGGAACTG
CCCATGGTCTCGGCCTACTCGGCGCGGAGGATCAGCGGCCGGGAGATCATGCCCGCCTCG
TTCTGGACGCGTCAGATGGCTGAGAAGGTGCGTTTCTGGGAGGCGCTCCGCCACAACTTC
GACTCCGGTCCCCGCACGTTCGTGGAAATCGGCCCAGGGACCGTCCTCTCCCTGGCCGCA
CGTCGGCTGCCGTCCGTACGGGCCCGGCGTTCCACGGTGATCTCCACGATGCCGCGTCAT
CGGCCCCACCCGGAGCACTGGGAATCGGCCATACATGAGGTCGCCGAGGAATTCTGTTGA
AT23..331
AT67..993

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [17-143]  2.19999999999997e-46 G3DSA:3.40.366.10 [210-326]  2.19999999999997e-46 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014043 Acyl transferase (Domain)
 [23-331]  8.39999999999997e-37 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [19-324]  3.1999989904635e-43 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [144-209]  1.10000029896148e-08 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
SignalP
 [1-32]  0.326 Signal
Bacteria, Gram-negative   
TMHMM No significant hit