close all open/close all

CDS information : Gilvo_00260


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction30,205 / 32,241 / + [in whole cluster]
30,205 / 32,241 / + [in contig]
Location30205..32241 [in whole cluster]
30205..32241 [in contig]
TypeCDS
Length2,037 bp (678 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative regulatory protein
Gene
Gene (GenBank)gilT
EC number
Keyword
Note
Note (GenBank)
  • GilT
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [putative regulatory protein]
MGFIRFDVLGPLRVRCDDTLLQLTGRKYRTVVSYLALQPEYSVAIEDLVRAAWSDKRPSS
AHHQVRKMVSALRTSLDQDWDLVATSQDGYMLKLPPKQSDVSEFCRLFDQVMSGPLTSDD
DLSAAYSALALWRGRPCEGSEPHGQERRISQLVEQHRVLLNKTVQGFGDRGRSDELASIL
HVASKIHGQPVTARSGVAVPAPAVSYAGTTQVPEPSGSTTPPPRPGSPVGPRCLPRDLQD
FGGREREINELQKLLTAEGPHPQLVATVHGMSGVGKTAVAVRLAHRLAHHYPDGQLFVSL
DGFSSASTATVSNALGILLRQKGLADEDISPSEDGRLAQWRTITAGQKLLVVLDDVCDIE
QVEPLIPPSSESACIITSRIILNGIDGAHHISLEVPDEDECLEILSCMIGRRFDDEETKD
ARALIQQCANLPLALRLAAARISTRDFLNLRELSEQLSSSASIFSELEVPGRSLVGRLMT
SFTCLEDFDHDRYLRLSLLPCPEIDETSVAAVLGVSTDWARRACRRFADRALLQRTRCGT
YRMHPLLLQAAQLEAQKTIPFEEQRRLVRAAFLHYKASNGLVGASRISPSRVPDGHVVLR
TLTQSAKLAARLGLQEELADLYTAWKELLPLVLDRRQQEAVGRRVLAVSQHLDRPACEGA
PHRRRPRQARDMLPEGQR
selected fasta
>hypothetical protein [putative regulatory protein]
ATGGGTTTCATCCGGTTTGACGTTCTGGGCCCGCTCAGGGTCCGGTGCGACGACACCCTG
CTTCAATTGACCGGGCGCAAGTACCGCACCGTGGTTTCGTATCTCGCTCTTCAACCCGAG
TATTCGGTGGCGATAGAGGACCTCGTCCGAGCCGCTTGGAGCGACAAGCGCCCGTCCAGC
GCGCACCACCAGGTCCGTAAGATGGTCTCCGCACTCCGGACCAGCCTGGACCAGGACTGG
GACCTGGTGGCGACGTCCCAGGACGGCTACATGCTGAAGTTGCCGCCCAAGCAGTCCGAC
GTATCCGAATTCTGCCGCCTCTTCGACCAGGTGATGTCGGGTCCCCTGACGAGCGACGAC
GACCTGTCGGCCGCGTATTCGGCGCTGGCGCTCTGGCGCGGACGCCCTTGCGAAGGGTCC
GAGCCCCATGGGCAGGAGCGCCGGATCTCTCAATTGGTGGAACAGCACCGCGTCCTCTTG
AACAAGACCGTTCAGGGATTCGGCGACAGGGGCAGGTCCGATGAACTCGCCTCGATACTG
CACGTCGCATCGAAGATTCACGGACAGCCGGTCACCGCTCGCTCCGGTGTCGCCGTTCCC
GCGCCCGCTGTTTCGTACGCGGGCACGACACAAGTCCCCGAACCTTCGGGGTCGACCACC
CCTCCCCCACGCCCCGGCTCCCCCGTCGGTCCGCGCTGCCTGCCACGGGATCTGCAGGAC
TTCGGCGGCCGCGAACGCGAAATCAATGAGCTGCAGAAACTGTTGACCGCGGAAGGACCC
CACCCACAGTTGGTGGCGACCGTTCACGGAATGAGCGGCGTGGGTAAAACCGCCGTCGCC
GTCCGCCTGGCGCACAGACTAGCCCATCACTATCCGGACGGCCAGCTCTTTGTATCCCTG
GACGGCTTTTCTTCGGCCTCCACCGCCACCGTGTCGAATGCGCTGGGAATACTCCTCAGA
CAGAAAGGCCTGGCGGACGAGGACATTTCACCTTCGGAAGACGGCCGCCTCGCACAATGG
CGGACCATCACCGCCGGACAGAAGCTGCTCGTCGTGCTCGACGACGTGTGCGACATCGAG
CAAGTAGAACCCCTCATCCCGCCCTCGAGCGAAAGCGCCTGCATCATCACGTCGCGCATC
ATCCTCAATGGCATCGACGGCGCTCATCACATCTCACTCGAAGTACCGGACGAGGACGAA
TGTCTGGAGATACTCAGTTGCATGATCGGCAGACGCTTCGACGACGAGGAGACGAAGGAC
GCCCGCGCGCTGATCCAGCAGTGCGCCAATCTGCCGCTGGCACTCCGTCTCGCCGCCGCC
CGGATATCGACGCGCGACTTCCTGAACCTCCGGGAACTCAGTGAGCAACTGTCGTCCTCG
GCTTCCATCTTCAGTGAACTGGAAGTTCCCGGCCGTAGTCTGGTCGGCCGGCTCATGACG
TCCTTCACGTGCCTGGAGGACTTCGATCACGACCGGTACCTCCGATTATCGCTGCTCCCC
TGCCCCGAGATCGATGAAACGTCGGTCGCGGCCGTGCTGGGCGTATCCACCGACTGGGCA
CGGCGTGCCTGCAGGCGCTTCGCAGACCGCGCGTTGCTGCAACGCACACGATGCGGTACG
TACCGGATGCACCCGCTGCTGCTGCAGGCGGCACAGCTGGAAGCGCAGAAGACCATCCCG
TTCGAGGAGCAACGCCGGCTCGTCCGCGCCGCTTTCCTCCATTACAAGGCGTCGAACGGC
CTCGTGGGAGCCAGCCGCATCAGCCCTTCCCGGGTTCCTGACGGACACGTGGTACTGAGG
ACCCTCACGCAGTCCGCGAAGCTGGCCGCGCGGCTCGGCCTCCAGGAGGAGTTGGCCGAT
CTGTACACCGCCTGGAAGGAACTGCTCCCCCTCGTGCTGGACCGCCGGCAGCAGGAGGCG
GTCGGGCGACGCGTACTCGCCGTTTCACAGCACCTGGACCGGCCCGCGTGCGAGGGAGCA
CCCCACCGGAGGCGTCCGCGGCAGGCACGGGACATGCTGCCCGAGGGGCAGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000767 Disease resistance protein (Family)
 [265-280]  1.39999892049878e-09 PR00364 [343-357]  1.39999892049878e-09 PR00364 [428-442]  1.39999892049878e-09 PR00364
PR00364   DISEASERSIST
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [18-92]  2.19999900980708e-05 SM00862
SM00862   Trans_reg_C
IPR002182 NB-ARC (Domain)
 [244-461]  3.8e-15 PF00931
PF00931   NB-ARC
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [13-95]  2.4e-07 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [3-93]  7.60000011115812e-11 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit