close all open/close all
Gilvo_00260 Gilvo_00260   last last

CDS information : Gilvo_00270


close this sectionLocation

Organism
StrainGö 3592
Entry nameGilvocarcin
Contig
Start / Stop / Direction32,447 / 33,394 / + [in whole cluster]
32,447 / 33,394 / + [in contig]
Location32447..33394 [in whole cluster]
32447..33394 [in contig]
TypeCDS
Length948 bp (315 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)putative NDP-sugar dehydratase/epimerase
Gene
Gene (GenBank)gilU
EC number5.1.3.-
Keyword
  • D-fucofuranose
Note
Note (GenBank)
  • GilU
Reference
ACC
PmId
[12822997] The complete gene cluster of the antitumor agent gilvocarcin V and its implication for the biosynthesis of the gilvocarcins. (J Am Chem Soc. , 2003)
[19067453] Inactivation of the ketoreductase gilU gene of the gilvocarcin biosynthetic gene cluster yields new analogues with partly improved biological activity. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [putative NDP-sugar dehydratase/epimerase]
MSERTVSAQEIVVGGGGLLGRHILGVLGNRLSRRVRIPWDDHGRACEQLYALGRDLAQQP
ARWNLYWCAGLAVFHTPAEQVERERLQVSLLLAGINDGLERSGGPTGGALFLASSAGGAF
AGSEHPPFTEFSPPVPTNPYGASKLAVEEEAEVLARRWRLPTVSGRITNLYGPGQNLDKN
QGLVSALVKAQLTGEPLRLRAALETTRDYIYARDCARMVVSAMETVRSRTRGTDPHVRKI
FSSGRRLRIDELLRIAERLFDRPVPVVHEPVAGGANVNLSVESRVWADLESSPFLSIEEG
MRAVRSDLRYRLGHG
selected fasta
>putative NDP-hexose C-4 ketoreductase [putative NDP-sugar dehydratase/epimerase]
GTGAGCGAGAGAACCGTCTCGGCGCAGGAGATCGTCGTGGGCGGCGGGGGTCTGCTGGGG
AGACACATCCTCGGCGTGCTGGGCAATCGGCTCAGCCGGCGGGTACGCATCCCGTGGGAC
GACCACGGCCGCGCCTGTGAGCAGCTCTACGCGCTGGGCAGGGACCTGGCTCAGCAGCCG
GCGCGCTGGAACCTGTACTGGTGCGCGGGACTGGCCGTCTTCCACACCCCCGCCGAGCAG
GTGGAGCGAGAACGCCTCCAGGTCAGCCTCCTCCTGGCGGGCATCAACGACGGGCTCGAA
CGCTCGGGGGGCCCCACCGGCGGCGCGTTGTTCCTGGCCTCCTCAGCCGGCGGCGCGTTC
GCGGGCTCGGAACACCCGCCGTTCACCGAGTTCTCCCCGCCCGTGCCCACGAACCCGTAC
GGCGCGTCCAAACTCGCCGTCGAGGAGGAGGCCGAGGTTCTGGCGCGCCGTTGGCGACTG
CCCACGGTGTCGGGTCGGATCACGAACCTGTACGGCCCCGGCCAGAACCTCGACAAGAAC
CAGGGCCTGGTCAGTGCCCTCGTCAAAGCGCAGCTGACCGGTGAACCCCTGCGGCTGCGG
GCCGCCCTGGAGACCACGCGCGACTACATCTACGCACGGGACTGCGCCCGGATGGTCGTC
TCGGCGATGGAGACCGTACGGTCCCGCACCCGCGGCACGGACCCCCATGTCCGCAAGATA
TTCAGCAGCGGACGCCGTCTGCGGATCGACGAACTGCTCCGGATCGCCGAGCGCCTCTTC
GACCGGCCGGTACCCGTCGTCCACGAGCCGGTGGCGGGAGGGGCGAACGTCAACCTCTCG
GTCGAGTCCCGGGTATGGGCGGACCTCGAATCGTCCCCCTTCCTCAGCATCGAGGAAGGG
ATGCGCGCCGTCCGCTCCGACCTCAGGTACCGACTCGGGCACGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [111-227]  8.30000000000004e-22 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [12-172]  2.90000000000001e-20 G3DSA:3.40.50.720 [219-251]  2.90000000000001e-20 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit
Gilvo_00260 Gilvo_00260   last last