close all open/close all
first first   Grana_00020 Grana_00020

CDS information : Grana_00010


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction2,400 / 1,099 / - [in whole cluster]
2,400 / 1,099 / - [in contig]
Locationcomplement(1099..2400) [in whole cluster]
complement(1099..2400) [in contig]
TypeCDS
Length1,302 bp (433 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative serine/threonine protein kinase
Product (GenBank)putative serine-threonine protein kinase
Gene
Gene (GenBank)gra-orf7
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in granaticin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
Related Reference
ACC
P54739
PmId
[7883195] Cloning, sequencing and expression of serine/threonine kinase-encoding genes from Streptomyces coelicolor A3(2). (Gene. , 1995)

close this sectionSequence

selected fasta
>putative serine/threonine protein kinase [putative serine-threonine protein kinase]
MGEVFAGRYELIDPIGRGGVGAVWRAWDHRRRRYVAAKVLQQSDAHTLLRFVREQALRID
HPHVLAPASWAADDDKVLFTMDLVAGGSLAHVIGDYGPLPPRFVCTLLDQLLSGLAAVHA
EGVVHRDIKPANILLDVTGTGRPHLRLSDFGISMRKGEPRLTETNYVVGTPGYFAPEQMM
GAEPDFPADLFAVGLVALYLLQGRKPDSRALIEYFLAHGTPGAPQGIPEPLWQVLAGLLQ
PDPQARFKTATGVRKALTAAVEMLPEAGPGEEPVEVFDQIGPCPPASARTARAPSPAAPA
PVRVQRHPEEPQQPQQPLPTLSETGSFHLPPPPRQQPAPPPQPVAAPAPHPAAVTPLAAH
TDPALAYVPTAAVPYEQASTRSYTAHAPRIPAQASPAAQSPAQRPGPPPKVAIPVLFVAL
ICFAVGIWALTQT
selected fasta
>putative serine/threonine protein kinase [putative serine-threonine protein kinase]
ATGGGTGAGGTCTTCGCGGGTCGGTACGAACTGATCGACCCGATCGGACGCGGTGGCGTA
GGAGCGGTCTGGCGCGCGTGGGACCACCGGCGCCGCCGCTATGTGGCGGCCAAGGTGCTC
CAGCAGAGCGATGCCCACACACTGCTCCGCTTCGTCCGGGAGCAGGCGCTCCGGATCGAC
CACCCCCACGTTCTCGCCCCGGCCAGCTGGGCCGCGGACGACGACAAGGTGCTGTTCACC
ATGGATCTGGTGGCCGGCGGCTCCCTGGCGCACGTCATCGGCGACTACGGCCCGCTGCCG
CCGCGCTTCGTCTGCACGCTGCTGGATCAGTTGCTCTCCGGCTTGGCCGCGGTGCACGCG
GAGGGGGTCGTGCACCGCGACATCAAGCCGGCGAACATCCTGCTCGACGTCACCGGGACC
GGGCGGCCGCATCTGCGGCTGTCCGATTTCGGCATCTCGATGCGCAAGGGCGAACCCCGC
CTGACCGAGACCAACTACGTGGTCGGGACGCCCGGTTATTTCGCGCCCGAGCAGATGATG
GGGGCGGAACCCGACTTCCCGGCCGACCTCTTCGCGGTCGGTCTCGTCGCGCTCTATCTG
CTCCAGGGCCGGAAGCCCGACTCCCGCGCCCTCATCGAGTACTTCCTGGCGCACGGGACG
CCGGGTGCCCCCCAGGGCATTCCGGAACCGCTGTGGCAGGTCCTCGCCGGTCTGCTCCAG
CCCGACCCGCAGGCCCGTTTCAAGACGGCCACGGGCGTGCGCAAGGCCCTGACCGCGGCG
GTCGAGATGCTGCCCGAGGCCGGCCCGGGCGAGGAGCCGGTCGAGGTCTTCGACCAGATC
GGCCCGTGCCCCCCGGCTTCGGCCCGAACGGCCCGAGCCCCTTCGCCAGCGGCCCCCGCC
CCCGTACGCGTCCAGCGGCACCCCGAGGAGCCGCAGCAGCCCCAGCAGCCGCTGCCGACC
CTTTCCGAGACCGGCAGCTTCCACCTGCCCCCGCCCCCGCGGCAGCAGCCCGCACCGCCC
CCGCAGCCGGTCGCCGCCCCCGCGCCGCACCCGGCCGCCGTCACGCCCCTCGCCGCGCAT
ACCGACCCCGCCCTCGCCTACGTCCCCACGGCCGCGGTGCCGTACGAACAAGCCTCCACC
CGTTCGTACACCGCTCACGCCCCGCGGATTCCCGCCCAGGCCTCACCGGCGGCGCAGAGC
CCGGCACAGCGGCCGGGACCGCCCCCGAAGGTGGCGATCCCGGTCCTGTTCGTCGCGCTG
ATCTGTTTCGCGGTCGGCATCTGGGCCCTCACCCAGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000719 Protein kinase, catalytic domain (Domain)
 [9-248]  2.19999999999997e-38 PF00069
PF00069   Pkinase
 [9-258]  PS50011
PS50011   PROTEIN_KINASE_DOM
IPR008271 Serine/threonine-protein kinase, active site (Active_site)
 [123-135]  PS00108
PS00108   PROTEIN_KINASE_ST
IPR011009 Protein kinase-like domain (Domain)
 [1-288]  1.49999648196323e-62 SSF56112
SSF56112   Kinase_like
SignalP No significant hit
TMHMM
 [411-430]  Transmembrane (o-i)
Transmembrane 1   
first first   Grana_00020 Grana_00020