close all open/close all

CDS information : Grana_00020


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction3,022 / 2,474 / - [in whole cluster]
3,022 / 2,474 / - [in contig]
Locationcomplement(2474..3022) [in whole cluster]
complement(2474..3022) [in contig]
TypeCDS
Length549 bp (182 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
Gene
Gene (GenBank)gra-orf8
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>hypothetical protein
MDAAQQEATARARELQRSWYGEPLGALFRRLIDDLGLNQARLAAVLGLSAPMLSQLMSGQ
RAKIGNPAVVQRVQALQELASQVADGSVSAAEATDRMDEIKKSQGGSVLTGTSQTTNSSG
APTVRRVVREIQSLLRSVAAAGDIIDAADSLAPAHPELAEFLRVYGAGRTGDAVAHYESH
QN
selected fasta
>hypothetical protein
ATGGATGCAGCGCAGCAGGAAGCCACGGCAAGAGCCCGAGAGCTTCAGCGCAGTTGGTAC
GGAGAGCCGCTGGGGGCGCTCTTCCGTCGTCTCATCGACGATCTCGGGCTGAACCAGGCC
AGGCTCGCGGCCGTGCTCGGACTGTCGGCACCCATGCTCTCCCAGCTGATGAGCGGCCAG
CGGGCCAAGATCGGCAACCCGGCGGTCGTCCAGCGCGTCCAGGCCCTGCAGGAGCTCGCG
AGCCAGGTCGCCGACGGCAGCGTCAGCGCGGCCGAGGCCACGGACCGGATGGACGAGATC
AAGAAGTCCCAGGGCGGCTCCGTGCTCACCGGCACCAGCCAGACCACCAACAGCTCGGGC
GCGCCGACCGTGCGCCGGGTGGTCCGCGAGATCCAGTCGCTGCTCCGCTCGGTCGCGGCC
GCCGGTGACATCATCGACGCGGCGGACTCCCTCGCCCCGGCCCACCCGGAGCTGGCAGAG
TTCCTCCGGGTGTACGGCGCCGGTCGCACCGGGGACGCGGTCGCCCACTACGAGTCGCAC
CAGAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [18-86]  9.69999663390112e-06 SSF47413
SSF47413   Lambda_like_DNA
 [25-62]  7.59999999999999e-06 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
SignalP No significant hit
TMHMM No significant hit