close all open/close all

CDS information : Grana_00030


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction3,462 / 4,313 / + [in whole cluster]
3,462 / 4,313 / + [in contig]
Location3462..4313 [in whole cluster]
3462..4313 [in contig]
TypeCDS
Length852 bp (283 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)pathway-specific transcriptional activator
Gene
Gene (GenBank)gra-orf9
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
[15358431] Widespread activation of antibiotic biosynthesis by S-adenosylmethionine in streptomycetes. (FEMS Microbiol Lett. , 2004)
Related Reference
ACC
P25047
NITE
Adria_00210
PmId
[1729206] Regulation of secondary metabolism in Streptomyces spp. and overproduction of daunorubicin in Streptomyces peucetius. (J Bacteriol. , 1992)
[7868593] Functional characterization and transcriptional analysis of the dnrR1 locus, which controls daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
[8971703] Purification and characterization of the DNA-binding protein DnrI, a transcriptional factor of daunorubicin biosynthesis in Streptomyces peucetius. (Mol Microbiol. , 1996)
[16545946] Feedback regulation of doxorubicin biosynthesis in Streptomyces peucetius. (Res Microbiol. , 2006)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>putative transcriptional regulator [pathway-specific transcriptional activator]
MDVGILGPLAVRLNGQSIVPSAGKPRQLLALLAIRAERVVTVPTLMEEIWGDAIPKSAAT
TLQTYILHLRRKVTAALRAGQPGAAADRAGTGAGAGDAKSVLSTCFGGYRLALRPEDSDL
REFQSLAARGSVALEAGDARAASAMLERALGLWRGTALVDVPVGRVLGVEVLGMEEQRTR
VLEQRIEADLLLGRHASLLAELRMLVARHPMNENLAAQLMTALYRSGGVWRALEVFQELR
RTLIEELGVEPSHRLQLLHRAVLSGELELDPRHAGLELMRTGG
selected fasta
>putative transcriptional regulator [pathway-specific transcriptional activator]
ATGGATGTTGGGATTCTCGGACCGCTCGCTGTCCGTCTGAACGGCCAGTCGATCGTGCCC
AGTGCGGGAAAGCCGCGCCAACTGCTCGCGCTGCTGGCCATCCGGGCGGAACGAGTGGTG
ACGGTGCCGACGCTGATGGAGGAGATCTGGGGTGACGCGATTCCCAAGAGCGCGGCGACC
ACACTGCAGACGTACATCCTCCATCTGCGCCGGAAGGTGACCGCGGCGCTGCGCGCCGGG
CAGCCGGGCGCCGCCGCTGATCGCGCCGGAACCGGGGCCGGGGCCGGGGACGCCAAGTCC
GTGCTCAGCACGTGCTTCGGCGGCTACCGCCTCGCCCTTCGCCCGGAGGACAGTGATCTG
CGCGAGTTCCAGTCCCTCGCGGCCCGTGGCTCGGTAGCGCTCGAGGCCGGTGACGCGCGC
GCCGCGTCCGCGATGCTGGAGCGGGCGCTCGGACTATGGCGCGGCACGGCGCTGGTGGAC
GTGCCGGTCGGACGCGTCCTGGGGGTGGAGGTCCTCGGCATGGAGGAGCAGCGCACCCGC
GTACTGGAGCAGCGCATAGAGGCGGACCTGCTGCTCGGGCGGCACGCCTCGCTCCTGGCC
GAGCTGCGGATGCTGGTCGCCCGGCACCCGATGAACGAGAACCTCGCCGCCCAGCTGATG
ACCGCGCTGTACCGGTCGGGCGGGGTCTGGCGGGCGCTGGAGGTCTTCCAGGAACTGCGC
AGGACGCTGATCGAGGAGCTGGGGGTGGAGCCCTCGCACCGGCTGCAGCTGCTGCACCGG
GCGGTGCTCTCCGGTGAGCTCGAGCTGGATCCCCGGCACGCCGGGCTCGAACTCATGCGG
ACCGGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [15-111]  3.09999999999998e-22 PF00486
PF00486   Trans_reg_C
 [15-111]  8.49999291746323e-11 SM00862
SM00862   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [118-263]  1e-47 SM01043
SM01043   BTAD
 [119-263]  7.5e-47 PF03704
PF03704   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [124-239]  0.00016 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [23-112]  5.8e-10 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-76]  6.49999377884395e-12 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit