close all open/close all

CDS information : Grana_00050


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction6,345 / 5,125 / - [in whole cluster]
6,345 / 5,125 / - [in contig]
Locationcomplement(5125..6345) [in whole cluster]
complement(5125..6345) [in contig]
TypeCDS
Length1,221 bp (406 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative two-component system histidine kinase
Product (GenBank)putative two-component sensory kinase
Gene
Gene (GenBank)gra-orf11
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
Related Reference
ACC
O34757
PmId
[15090506] The membrane fluidity sensor DesK of Bacillus subtilis controls the signal decay of its cognate response regulator. (J Bacteriol. , 2004)
Family/Domain
FD
IPR011712

close this sectionSequence

selected fasta
>putative two-component system histidine kinase [putative two-component sensory kinase]
MNSREQQFDELDSSASYLSHEDSDLPAPRLARTVLLAAMAGYSLVTVVNILGAGLSPAET
CVGFTALLVVFGLQVAHSRPQARQSPYWRRVTTLTLQAVFCFVPLALFHMAWGAMGGFLA
GSVLLLLPGRAAWPLYGAIGASLFAYSAAAGHTLLDSVYTLEATLVTGLVVFGLSSLTGL
VTRLHAHRADLARLAVAGERLRFSRDLHDLLGYNLSAITLKTELVRRLVPDMPERARDET
DSILALSRQSLADVRKVATGYRDMSLREEAAATRSMLEAAGIEVEAAIDIGPLPSQIDTV
LATVLREGVTNALRHSRVHHCTIRCWEKDGVVTLSLGNDGVDPEDGGYEGVDRDARRADD
PGGTGLGNLTYRLTRVGGSLTTELSDNGWFRMTARAPVHPHVCTTR
selected fasta
>putative two-component system histidine kinase [putative two-component sensory kinase]
ATGAACTCACGTGAACAGCAGTTCGACGAGCTGGACAGCAGTGCCTCGTACCTCTCTCAC
GAGGACTCCGACCTGCCCGCCCCGAGGCTGGCCCGCACCGTCCTGCTGGCCGCGATGGCC
GGCTATTCCCTGGTCACGGTGGTGAACATCCTGGGCGCCGGACTGTCACCCGCCGAAACC
TGTGTCGGATTCACCGCACTGCTCGTGGTGTTCGGACTCCAGGTCGCCCACTCCCGCCCG
CAGGCCCGCCAGAGCCCTTACTGGCGCCGCGTGACCACCCTGACGTTGCAGGCCGTCTTC
TGTTTCGTACCGCTGGCGCTGTTTCACATGGCGTGGGGAGCGATGGGTGGCTTCTTGGCC
GGTTCCGTACTCCTGCTGCTGCCCGGCCGGGCGGCCTGGCCGCTCTACGGCGCGATCGGG
GCGTCGCTCTTCGCGTACTCGGCCGCGGCCGGCCACACCCTGCTCGACAGCGTCTACACC
TTGGAGGCCACGCTCGTCACCGGGCTCGTGGTGTTCGGACTGAGCAGCCTGACCGGTCTC
GTGACCCGGCTGCACGCGCACCGCGCCGACCTGGCCCGGCTCGCGGTCGCCGGCGAGCGG
CTCCGCTTCTCCCGCGACCTGCACGACCTGCTCGGCTACAACCTGTCCGCGATCACCCTC
AAGACCGAGCTGGTACGCCGCCTCGTGCCGGACATGCCGGAGCGGGCCAGGGACGAGACC
GACTCGATCCTCGCCCTCTCCCGCCAGTCGCTGGCCGACGTGCGCAAGGTCGCCACCGGC
TACCGCGACATGTCTCTGCGCGAGGAGGCCGCCGCCACCCGCTCGATGCTGGAGGCGGCG
GGCATAGAGGTGGAGGCGGCCATCGACATAGGCCCGCTGCCCTCCCAGATCGACACGGTG
CTCGCCACCGTGCTCCGCGAGGGCGTCACCAATGCCCTCCGGCACAGCCGCGTCCACCAC
TGCACCATCCGGTGCTGGGAGAAGGACGGCGTGGTCACGCTCAGCCTCGGCAACGACGGC
GTGGACCCGGAGGACGGCGGCTACGAGGGCGTGGACCGCGACGCGCGGAGGGCGGACGAC
CCGGGCGGCACCGGCCTCGGCAACCTCACCTACCGACTGACCCGCGTCGGCGGCAGCCTC
ACCACCGAGCTGAGCGACAACGGCTGGTTCCGGATGACCGCCCGGGCCCCGGTGCACCCG
CACGTCTGCACCACCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [300-398]  1.3e-05 PF02518
PF02518   HATPase_c
 [262-401]  1.80000149287196e-09 SSF55874
SSF55874   ATP_bd_ATPase
 [270-399]  8.09999999999999e-05 G3DSA:3.30.565.10
G3DSA:3.30.565.10   ATP_bd_ATPase
IPR011712 Signal transduction histidine kinase, subgroup 3, dimerisation and phosphoacceptor domain (Domain)
 [199-265]  5.10000000000001e-16 PF07730
PF07730   HisKA_3
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [34-56]  Transmembrane (i-o) [105-127]  Transmembrane (o-i) [132-154]  Transmembrane (i-o) [159-181]  Transmembrane (o-i)
Transmembrane 4