close all open/close all

CDS information : Grana_00060


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction8,971 / 6,716 / - [in whole cluster]
8,971 / 6,716 / - [in contig]
Locationcomplement(6716..8971) [in whole cluster]
complement(6716..8971) [in contig]
TypeCDS
Length2,256 bp (751 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productbacteriocin biosynthesis cyclodehydratase domain protein
Product (GenBank)
Gene
Gene (GenBank)gra-orf12
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
Related Reference
ACC
Q52QI6
PmId
[15883371] Patellamide A and C biosynthesis by a microcin-like pathway in Prochloron didemni, the cyanobacterial symbiont of Lissoclinum patella. (Proc Natl Acad Sci U S A. , 2005)
Family/Domain
FD
IPR022291

close this sectionSequence

selected fasta
>bacteriocin biosynthesis cyclodehydratase domain protein
MTGEAVYLVSGRGVRAVRGAPAEALAPLLDGTRTPDEVLREAARARDARRPLPRGVRRAL
AELWSAGLLRAHPDPAATPGTGAGPPAAHDRSAEAFWDLAGTTPPARTAVRLLVLDGPVS
EEEARAACAASGLDVGRPGAQASDAEVTLVLCTDYLDPRLADVDALQRAAGRPWILARPG
GPEAWTGPVLRPDDGPCWHCLAERLRLQRGSEAPLHRALGCTSPVARPDASLAASRAAGL
HTAVLETAKWLAGVPGPTRDAVHTVDALTLDSARHPVARRPQCPSCGDAGLVRARVRAPF
VPAPRPKAADGGNGHRALSPREVLERYGHLVGPVTGVVREVRRDPRSPAFTHSFLSGHNL
AMRAPTLAGHSAGLRALSGGKGLTSEEARVSALCEAVERYSGSRHGDEPVVRDSFRAFGP
AAVHPDTVRLYDPRQLRDRDAWNASGSPFQYVGRPFDEDAPVDWTPVWSLTGGVQRLLPT
SLLYFDADPAAPLRADSNGNAAGSSPEDAFVQGFLELVERDAVALWWYNRTRAPACDLDA
FAASGDAWIEPLRAGYRSLGREIWALDLTSDFGIPVVAALSRRTDGPPEDVLFGFGAHLD
PRIAVRRALTEMGQLLPAVVDARPDGSGYTVDDPHALSWWRTATVAGQPHLLPDPQRAPS
RPGSWTYTARADLSEDVAALAALADERGLEVLVLDQTRPDIGLPVVKVVVPGMRQFWPRF
APGRLFDVPVALGRLAEPTPYERLNPLPLFV
selected fasta
>bacteriocin biosynthesis cyclodehydratase domain protein
GTGACGGGCGAGGCGGTGTATCTGGTCTCCGGCCGGGGGGTTCGCGCGGTGCGCGGCGCC
CCGGCCGAGGCGCTGGCCCCCCTGCTCGACGGCACCCGCACCCCCGACGAGGTGCTGCGT
GAGGCCGCGCGCGCGCGCGACGCCCGCCGCCCCCTCCCCCGAGGAGTGCGCCGCGCCCTC
GCCGAACTCTGGTCCGCCGGTCTCCTCCGCGCCCACCCGGACCCCGCCGCGACCCCCGGC
ACGGGGGCCGGGCCACCGGCCGCCCACGACCGCTCGGCCGAGGCCTTCTGGGATCTCGCC
GGCACCACCCCGCCCGCACGTACGGCCGTACGACTGCTCGTCCTCGACGGCCCGGTGTCG
GAGGAGGAGGCGCGGGCCGCCTGCGCCGCCTCGGGGCTCGACGTCGGCCGCCCCGGCGCC
CAGGCGTCGGACGCCGAGGTCACCCTGGTGCTCTGCACCGACTATCTGGACCCGCGCCTC
GCCGACGTCGACGCGCTCCAGCGCGCCGCCGGCCGCCCCTGGATCCTGGCTCGCCCCGGC
GGACCCGAGGCCTGGACCGGCCCGGTCCTGCGTCCCGACGACGGCCCCTGCTGGCACTGT
CTCGCCGAACGCCTGCGCCTCCAGCGCGGCTCTGAGGCCCCCCTGCACCGCGCTCTGGGC
TGTACGAGCCCGGTCGCGCGGCCCGACGCCTCGCTCGCCGCGAGCCGCGCGGCCGGCCTG
CACACCGCCGTCCTGGAGACCGCCAAGTGGCTGGCCGGCGTGCCCGGTCCGACCCGCGAC
GCGGTCCACACCGTCGACGCCCTCACGCTCGACTCGGCCCGGCATCCGGTGGCCCGCCGC
CCCCAGTGCCCCTCCTGCGGCGACGCCGGTCTCGTCCGCGCACGGGTCCGCGCCCCCTTC
GTCCCCGCCCCCCGGCCCAAGGCGGCGGACGGCGGCAACGGCCACCGCGCCCTGTCGCCG
CGCGAGGTGCTGGAGCGCTACGGCCACCTGGTGGGCCCGGTCACCGGCGTCGTACGCGAG
GTGCGCCGCGACCCCCGCAGCCCCGCCTTCACCCACAGCTTTCTCTCCGGGCACAACCTG
GCGATGCGCGCCCCGACCCTGGCCGGACACAGTGCCGGGCTGCGGGCGCTCAGCGGCGGC
AAGGGCCTCACCTCCGAGGAGGCCAGGGTCAGTGCCCTGTGCGAGGCCGTCGAGCGCTAC
AGCGGCTCCCGGCACGGCGACGAGCCCGTGGTCCGCGACAGCTTCCGGGCGTTCGGCCCC
GCCGCCGTCCACCCGGACACCGTGCGGCTCTACGACCCCCGCCAGCTGCGCGACCGGGAC
GCCTGGAACGCCTCCGGTTCCCCATTCCAGTACGTCGGCCGCCCCTTCGACGAGGACGCC
CCGGTCGACTGGACGCCGGTGTGGTCCCTGACCGGAGGCGTCCAGAGGCTGCTGCCCACC
TCGCTCCTCTACTTCGACGCCGACCCCGCCGCCCCACTGCGCGCCGACTCCAACGGAAAC
GCCGCCGGTTCCAGCCCCGAGGACGCCTTCGTTCAGGGCTTTCTGGAGCTGGTCGAACGC
GACGCCGTCGCCCTGTGGTGGTACAACCGCACCCGGGCGCCCGCCTGCGACCTGGACGCC
TTCGCCGCCTCGGGCGACGCCTGGATCGAGCCGCTGCGCGCGGGCTACCGCTCCCTGGGC
CGCGAGATCTGGGCCCTGGACCTGACCTCCGACTTCGGCATCCCGGTGGTGGCCGCCCTG
TCCCGGCGCACCGACGGACCGCCGGAGGACGTGCTGTTCGGCTTCGGCGCCCACCTCGAT
CCGCGCATCGCGGTGCGCCGCGCGCTCACGGAGATGGGCCAGTTGCTGCCGGCGGTCGTC
GACGCCCGCCCGGACGGATCCGGTTACACCGTGGACGACCCGCACGCCCTCTCCTGGTGG
CGCACCGCCACCGTCGCCGGTCAGCCCCACCTGCTGCCCGATCCACAGCGCGCCCCGAGC
CGGCCCGGCAGTTGGACGTACACAGCGCGCGCCGACCTCTCCGAGGACGTGGCGGCGCTC
GCCGCGCTCGCCGACGAGCGGGGTCTGGAGGTCCTCGTCCTGGACCAGACGCGACCGGAC
ATCGGGCTTCCGGTCGTGAAGGTCGTGGTCCCCGGCATGCGCCAGTTCTGGCCACGTTTC
GCGCCGGGCCGCCTCTTCGACGTGCCGGTCGCGCTCGGCCGGCTCGCCGAGCCCACTCCG
TACGAACGCCTCAACCCGCTGCCGTTGTTCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003776 YcaO-like (Domain)
 [379-714]  4.69999999999992e-93 PF02624
PF02624   YcaO
 [376-715]  1.5e-30 TIGR00702
TIGR00702   TIGR00702
IPR009036 Molybdenum cofactor biosynthesis, MoeB (Domain)
 [150-287]  3.6000003870074e-07 SSF69572
SSF69572   MoeB
IPR016040 NAD(P)-binding domain (Domain)
 [150-287]  1.4e-09 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR022291 Bacteriocin biosynthesis, cyclodehydratase domain (Domain)
 [172-338]  1.09999999999999e-47 TIGR03882
TIGR03882   Cyclo_dehyd_2
SignalP
 [1-19]  0.179 Signal
Eukaryota   
TMHMM No significant hit