close all open/close all

CDS information : Grana_00070


close this sectionLocation

Organism
StrainTü22
Entry nameGranaticin
Contig
Start / Stop / Direction9,232 / 9,059 / - [in whole cluster]
9,232 / 9,059 / - [in contig]
Locationcomplement(9059..9232) [in whole cluster]
complement(9059..9232) [in contig]
TypeCDS
Length174 bp (57 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
Gene
Gene (GenBank)gra-orf13
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>hypothetical protein
MNHVLAENPSWAAVLAPDTARVPATLTIEDLDTVPDDAAALFTLCVLAPEPAETVAA
selected fasta
>hypothetical protein
ATGAACCACGTCCTCGCCGAGAACCCCTCCTGGGCCGCCGTCCTCGCCCCGGACACCGCG
CGGGTCCCGGCCACGCTGACGATCGAGGACCTGGACACGGTCCCGGACGACGCGGCGGCG
CTGTTCACCCTCTGCGTCCTCGCCCCGGAGCCGGCCGAGACCGTCGCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-12]  0.281 Signal
Bacteria, Gram-negative   
TMHMM No significant hit